DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and AT3G14530

DIOPT Version :9

Sequence 1:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_188071.1 Gene:AT3G14530 / 820678 AraportID:AT3G14530 Length:360 Species:Arabidopsis thaliana


Alignment Length:326 Identity:72/326 - (22%)
Similarity:120/326 - (36%) Gaps:91/326 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILQKTKDKSTQKEQDEILLQPFT------YIQQIPGKQFRSELALAFNHWLLIPGEKLAQIGD-- 63
            :::|.:..:...:....||:|.|      |.....||:.|..|.:|...  |:.|::...:..  
plant    70 MIRKAESVNAALDVSVPLLKPLTIQEAVRYSLLAGGKRVRPLLCIAACE--LVGGDEATAMSAAC 132

  Fly    64 IVQMLHNSSLLIDDIE--DNSILRRGVPVAHSIYGVASTINAANYALFLALEKV----QQLDHPE 122
            .|:|:|.|||:.||:.  ||:.||||.|..|.:||....:.|.:..|.||.|.:    ..|..||
plant   133 AVEMIHTSSLIHDDLPCMDNADLRRGKPTNHKVYGEDMAVLAGDALLALAFEHMTVVSSGLVAPE 197

  Fly   123 --------------ATKVYTEQLLELHRGQ------GMEIYWRDSFTCPSESDYKLMTVRKTGGL 167
                          .|.:...|:::|...:      |:|             ..:.:.:.||..|
plant   198 KMIRAVVELARAIGTTGLVAGQMIDLASERLNPDKVGLE-------------HLEFIHLHKTAAL 249

  Fly   168 FMLAIRLMQLFSSNKED----YSKLTAILGLYFQIRDDYCNLSLKEYTENKSFAEDLTEGKFGFP 228
            ...|..|..:.....|.    ..|....:||.||:.||..:::.......|:..:|:..||..:|
plant   250 LEAAAVLGVIMGGGTEQEIEKLRKYARCIGLLFQVVDDILDVTKSTEELGKTAGKDVMAGKLTYP 314

  Fly   229 VIHAVRTQKQDKQVLHILRQRTHDIEVKKYCITLLEKLGSFQYTRKVLESLDAEARSEVARLGSN 293
                                                :|...:.:|:|.|.|..||..::  ||.:
plant   315 ------------------------------------RLIGLEGSREVAEKLRREAEEQL--LGFD 341

  Fly   294 P 294
            |
plant   342 P 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 57/268 (21%)
AT3G14530NP_188071.1 IspA 65..334 CDD:223220 68/314 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981769at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.