DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and AT3G14510

DIOPT Version :9

Sequence 1:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_188069.1 Gene:AT3G14510 / 820674 AraportID:AT3G14510 Length:284 Species:Arabidopsis thaliana


Alignment Length:300 Identity:66/300 - (22%)
Similarity:113/300 - (37%) Gaps:85/300 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLQPFT------YIQQIPGKQFRSELALAFNHWLLIPGEKLAQIGD--IVQMLHNSSLLIDDIE- 79
            |.:|.|      |.....||:.|..|.:|...  |:.|::...:..  .|:|:|.|||:.||:. 
plant    11 LREPLTVQEAVRYSLLAGGKRVRPLLCIAVCE--LVGGDEATAMSAACAVEMIHTSSLIHDDLPC 73

  Fly    80 -DNSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQLDHPEATKVYTEQLL----ELHR--- 136
             ||:.||||.|..|.::|....:.|.:..|.||.|.:..:   .:..|.:|:::    ||.|   
plant    74 MDNADLRRGKPTNHKVFGEDMAVLAGDALLALAFEHMTVV---SSGLVASERMIRAVVELARAIG 135

  Fly   137 ------GQGMEIYWRDSFTCPSE---------SDYKLMTVRKTGGLFMLAIRLMQLFSSNKED-- 184
                  ||.:::        .||         ...:.:.:.||..|...|..:..:.....|:  
plant   136 TKGLVAGQVVDL--------SSERLNPHDVGLERLEFIHLHKTAALLEAAAVIGAIMGGGTEEEI 192

  Fly   185 --YSKLTAILGLYFQIRDDYCNLSLKEYTENKSFAEDLTEGKFGFPVIHAVRTQKQDKQVLHILR 247
              ..|....:||.||:.||..:::.......|:..:|:..||..:|                   
plant   193 EKLRKYARCIGLLFQVVDDILDVTKSTEELGKTAGKDVMAGKLTYP------------------- 238

  Fly   248 QRTHDIEVKKYCITLLEKLGSFQYTRKVLESLDAEARSEV 287
                             :|...:.:|:|.|.|..||..::
plant   239 -----------------RLIGLERSREVAEKLSREAEEQL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 56/266 (21%)
AT3G14510NP_188069.1 Trans_IPPS_HT 19..279 CDD:173833 63/291 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981769at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.