DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and AT2G18620

DIOPT Version :9

Sequence 1:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_179452.1 Gene:AT2G18620 / 816377 AraportID:AT2G18620 Length:347 Species:Arabidopsis thaliana


Alignment Length:250 Identity:61/250 - (24%)
Similarity:103/250 - (41%) Gaps:46/250 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GKQFRSELALAFNHWLLIPGEKLAQI--GDIVQMLHNSSLLIDDIE--DNSILRRGVPVAHSIYG 96
            ||:.|..|.:|...  |:.||:...:  ...|:|:|..||:.||:.  ||..||||.|..|.::|
plant    94 GKRVRPVLCIAACE--LVGGEESVALPAACAVEMIHTMSLIHDDLPCMDNDDLRRGKPTNHKVFG 156

  Fly    97 VASTINAANYALFLALE---------------KVQQLDHPEATK-VYTEQLLELHRGQGMEIYWR 145
            ....:.|.:..:..|.|               .:.:|.....:| :...|:::|..| ||:    
plant   157 EDVAVLAGDALISFAFEHLATSTAVSPARVVRAIGELAKAIGSKGLVAGQVVDLTSG-GMD---- 216

  Fly   146 DSFTCPSESDYKL-----MTVRKTGGLFMLAIRLMQLF-SSNKEDYSKL---TAILGLYFQIRDD 201
                   ::|..|     :.|.||..|...|..|..:. ..:.|:..||   ...:||.||:.||
plant   217 -------QNDVGLEVLEFIHVHKTAVLLEAATVLGAIVGGGSDEEVEKLRRFARCIGLLFQVVDD 274

  Fly   202 YCNLSLKEYTENKSFAEDLTEGKFGFPVIHAVRTQKQ--DKQVLHILRQRTHDIE 254
            ..:::.......|:..:||...|..:|.:..:...|.  || :|....::.|..:
plant   275 ILDVTKSSEELGKTAGKDLIADKLTYPKLMGLEKSKDFADK-LLSDAHEQLHGFD 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 61/249 (24%)
AT2G18620NP_179452.1 Trans_IPPS_HT 82..345 CDD:173833 61/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981769at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.