DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and Pdss2

DIOPT Version :9

Sequence 1:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_082048.2 Gene:Pdss2 / 71365 MGIID:1918615 Length:401 Species:Mus musculus


Alignment Length:271 Identity:50/271 - (18%)
Similarity:101/271 - (37%) Gaps:67/271 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IGDIVQMLHNSSLLIDDIEDNSILRRG-VPVAHSIYGVASTINAANYALFLALEKVQQLDHPEAT 124
            :.:|.:::|.:.|:...|.:.|.|:.. .|:....:|....|.:.::.|..|...:..|.:.:..
Mouse   149 LAEITELIHTALLVHRGIVNLSELQSSDGPLKDMQFGNKIAILSGDFLLANACNGLALLQNTKVV 213

  Fly   125 KVYTEQLLELHRGQGMEIYWRDSFTCPSES---DYKLMTVRKTGGL---FMLAIRLMQLFSSNKE 183
            ::.:..|::|..|    :|..:|.:....|   |..:.|.::...|   .:||..........|.
Mouse   214 ELLSSALMDLVHG----VYQENSASTKENSIPDDIGISTWKEQTFLSHCALLAKSCQAAMELAKH 274

  Fly   184 DYSKLTAILGLYFQ-----IRDDYCNLSLKEYTENKSFAEDLTEGKFGFPVIHAVRTQKQDKQVL 243
            |    .|:..:.||     ......|..|:.:.::|: ::..|......||              
Mouse   275 D----AAVQDMAFQYGKHMAMSHKINADLQPFIKDKA-SDSKTFNLNSAPV-------------- 320

  Fly   244 HILRQR--THDIEVKKYCITLLEKLGSFQYTR-----------------------KVLESLD--- 280
             :|.|.  ..|:.:|:  |...::.||..|::                       |.||:|:   
Mouse   321 -VLHQEFLGRDLWIKQ--IGEAQEKGSLNYSKLRETIKAGKGVTSAIDLCRYHGNKALEALESFP 382

  Fly   281 -AEARSEVARL 290
             :||||.:..:
Mouse   383 PSEARSALENI 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 39/219 (18%)
Pdss2NP_082048.2 Isoprenoid_Biosyn_C1 69..401 CDD:294142 50/271 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.