DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and PDSS2

DIOPT Version :9

Sequence 1:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_011534258.1 Gene:PDSS2 / 57107 HGNCID:23041 Length:465 Species:Homo sapiens


Alignment Length:312 Identity:61/312 - (19%)
Similarity:105/312 - (33%) Gaps:100/312 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 HWLLIPGEKLAQIGDIVQMLHNSSLLIDDIEDNSI-LRRGVPVAHSIYGVA-------------- 98
            ||..:..|....:|.....:....||.|::.:.:: :|:.|...|.:...|              
Human    48 HWNQVVSEAEKIVGYPTSFMSLRCLLSDELSNIAMQVRKLVGTQHPLLTTARGLVHDSWNSLQLR 112

  Fly    99 -------------STINAA--NYALFLALEKVQQLDHPEATKVYTEQLLELHRGQGMEIYWRDSF 148
                         |::|.:  ||.:...:...|: ...|.|::....|| :|||           
Human   113 GLVVLLISKAAGPSSVNTSCQNYDMVSGIYSCQR-SLAEITELIHIALL-VHRG----------- 164

  Fly   149 TCPSESDYKLMTVRKTGGLFMLAIRLMQLFSSN---KE-DYSKLTAILGLYFQIRDDYCNLSLKE 209
                                  .:.|.:|.||:   |: .:....|||...|.:.:....|:|.:
Human   165 ----------------------IVNLNELQSSDGPLKDMQFGNKIAILSGDFLLANACNGLALLQ 207

  Fly   210 YTE----NKSFAEDLTEGKFGFPVIHAVRTQKQ----DKQVLHILRQRT---HDIEVKKYCITLL 263
            .|:    ..|...||.:|     |.|...|.|:    |...:...:::|   |...:.|.|...:
Human   208 NTKVVELLASALMDLVQG-----VYHENSTSKESYITDDIGISTWKEQTFLSHGALLAKSCQAAM 267

  Fly   264 EKLGSFQYTRKVLESLDAEARSEVARLGSNPYMDRLLNK----LLSWKTSDS 311
            |           |...|||.::...:.|.:..|...:|.    .:..|||||
Human   268 E-----------LAKHDAEVQNMAFQYGKHMAMSHKINSDVQPFIKEKTSDS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 49/262 (19%)
PDSS2XP_011534258.1 Isoprenoid_Biosyn_C1 68..465 CDD:294142 57/292 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.