DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and fdps

DIOPT Version :9

Sequence 1:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001020642.1 Gene:fdps / 552997 ZFINID:ZDB-GENE-050506-78 Length:356 Species:Danio rerio


Alignment Length:273 Identity:59/273 - (21%)
Similarity:103/273 - (37%) Gaps:67/273 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IILQKTKDKSTQKEQDEILLQPFTYIQQI------PGKQFRSELALAFNHWLLIPGE-------K 57
            ::.:.|:...|    |.:|......::::      .||:.|....:.....|:.|.|       :
Zfish    27 LVCELTEQDFT----DPVLSDALNRLREVLQYNAPGGKRNRGLSVIGSLRELVSPSELPTEEVHR 87

  Fly    58 LAQIGDIVQMLHNSSLLIDDIEDNSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQL---- 118
            ...:|..:::|....|:.|||.|:|:.|||.|..:....:.  ::|.|.| ||....:.:|    
Zfish    88 ALLVGWCIELLQAFFLVADDIMDSSVTRRGQPCWYKKEAIG--LDAINDA-FLLEGSIYRLLRRH 149

  Fly   119 -----DHPEATKVYTEQLLELHRGQGMEIYWRDSFTCP---------SESDYKLMTVRKTG---- 165
                 .:....:::||...:...||.:     |..|.|         :...||.:...||.    
Zfish   150 CRGQPYYVHLLELFTETSFQTELGQAL-----DLMTAPPHKIDLNRFTMERYKAIVKYKTAFYSF 209

  Fly   166 GLFMLAIRLMQLFSSNKEDYSKLTAIL--GLYFQIRDDYCNLSLKEYTENKSFAEDLTEGKFGFP 228
            .|.:.|...|....:..|.::..|.:|  |.:|||:|||.:          .|.:....||.|  
Zfish   210 YLPVAAAMYMAGIENEIEHHNAKTILLEMGEFFQIQDDYLD----------CFGDPAVTGKIG-- 262

  Fly   229 VIHAVRTQKQDKQ 241
                  |..||.:
Zfish   263 ------TDIQDNK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 55/249 (22%)
fdpsNP_001020642.1 polyprenyl_synt 53..314 CDD:278763 55/243 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.