DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and pdss1

DIOPT Version :9

Sequence 1:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001017656.1 Gene:pdss1 / 550349 ZFINID:ZDB-GENE-030131-4430 Length:411 Species:Danio rerio


Alignment Length:346 Identity:74/346 - (21%)
Similarity:143/346 - (41%) Gaps:70/346 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LQKTKDKSTQKEQDEILLQPFTYIQQI-----------------------------PGKQFRSEL 43
            |..|...|.....|..|..||:.:|:.                             .||.||..:
Zfish    72 LYSTPRVSCSLHSDAKLKDPFSLVQKDLQNIYDDIKQQLLVSKAELKALCDYYFDGKGKAFRPMI 136

  Fly    44 ALAF---------NHWLLIPGEKLAQIGDIVQMLHNSSLLIDDIEDNSILRRGVPVAHSIYGVAS 99
            .:..         ...:|:|.::  .|..|.:|:|.:||:.||:.|:|..|||....::::|...
Zfish   137 VILMARACNVHSNKEGVLLPAQR--SIAMISEMIHTASLVHDDVIDDSDKRRGKNTINNVWGERK 199

  Fly   100 TINAANYALFLALEKVQQLDHPEATKVYTEQLLELHRGQGMEIYWRDSFTCPSESD----YKLMT 160
            .|.|.::.|..|...:.::.:.....|.::.:.:|.||:.|::..::     :|::    |...|
Zfish   200 AILAGDFILSAASMALARIGNTTVVSVLSQVIEDLVRGEFMQLGSKE-----NENERFKHYLEKT 259

  Fly   161 VRKTGGLFMLAIRLMQLFSSNKEDYSKLT----AILGLYFQIRDDYCNLSLKEYTEN-----KSF 216
            .:||..|...:.:.:.:..::..:..::.    ..:|:.||:.||     :.::|.|     |..
Zfish   260 FKKTASLIANSCKAVSILVNSDPEVHEIAYQYGRNVGIAFQLVDD-----ILDFTSNANCLGKPS 319

  Fly   217 AEDLTEGKFGFPVIHAVRTQKQDKQVLH--ILRQRTHDIEVKKYCITLLEKLGSFQYTRKVLESL 279
            |.||..|....||:.|.    |....||  |:|:.:.|.:|.:....:|:..| .:.|..:.:..
Zfish   320 AADLKLGLATGPVLFAC----QQFPELHSMIMRRFSSDGDVDRAWQYVLKSDG-VEQTNYLAQHY 379

  Fly   280 DAEARSEVARLGSNPYMDRLL 300
            ..||..:::||..:...|.|:
Zfish   380 CQEAIRQISRLRPSSERDALI 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 59/289 (20%)
pdss1NP_001017656.1 PLN02890 26..411 CDD:178478 74/346 (21%)
Isoprenoid_Biosyn_C1 92..409 CDD:294142 68/326 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.