DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and ggps1

DIOPT Version :9

Sequence 1:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001017122.1 Gene:ggps1 / 549876 XenbaseID:XB-GENE-944146 Length:296 Species:Xenopus tropicalis


Alignment Length:289 Identity:169/289 - (58%)
Similarity:226/289 - (78%) Gaps:0/289 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 STQKEQDEILLQPFTYIQQIPGKQFRSELALAFNHWLLIPGEKLAQIGDIVQMLHNSSLLIDDIE 79
            ::::..:.|||:|:.|:.|:||||.|::|:.||||||.:|.:|:..|.::.:||||:||||||||
 Frog     3 NSKEVSERILLEPYKYLLQLPGKQIRTKLSQAFNHWLNVPEDKIQVIIEVTEMLHNASLLIDDIE 67

  Fly    80 DNSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQLDHPEATKVYTEQLLELHRGQGMEIYW 144
            |||.||||.||||||||:.|.||:|||..||.||||..|:||.|..|:|:||||||||||::|||
 Frog    68 DNSKLRRGFPVAHSIYGIPSVINSANYVYFLGLEKVLTLNHPNAVHVFTQQLLELHRGQGLDIYW 132

  Fly   145 RDSFTCPSESDYKLMTVRKTGGLFMLAIRLMQLFSSNKEDYSKLTAILGLYFQIRDDYCNLSLKE 209
            ||::|||:|::||.|.::||||||.||:.|||||||..:|...|...|||:|||||||.||:.||
 Frog   133 RDTYTCPTEAEYKAMVLQKTGGLFGLAVGLMQLFSSYDKDLKPLLNTLGLFFQIRDDYANLNSKE 197

  Fly   210 YTENKSFAEDLTEGKFGFPVIHAVRTQKQDKQVLHILRQRTHDIEVKKYCITLLEKLGSFQYTRK 274
            |:|||||.||||||||.||.|||:.::.:..||.:||||||.::::||||:..|||:|||:||::
 Frog   198 YSENKSFCEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENVDIKKYCVHYLEKVGSFEYTKE 262

  Fly   275 VLESLDAEARSEVARLGSNPYMDRLLNKL 303
            .|..|:|||...:..||.||.:..|:.:|
 Frog   263 TLRELEAEAYKHIESLGGNPQLASLIEQL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 149/236 (63%)
ggps1NP_001017122.1 polyprenyl_synt 9..251 CDD:376322 150/241 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 304 1.000 Domainoid score I1376
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31267
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62161
OrthoDB 1 1.010 - - D458107at33208
OrthoFinder 1 1.000 - - FOG0007302
OrthoInspector 1 1.000 - - oto104853
Panther 1 1.100 - - LDO PTHR12001
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2131
SonicParanoid 1 1.000 - - X7
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.060

Return to query results.
Submit another query.