DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and pdss2

DIOPT Version :9

Sequence 1:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001008170.1 Gene:pdss2 / 493532 XenbaseID:XB-GENE-945063 Length:389 Species:Xenopus tropicalis


Alignment Length:307 Identity:57/307 - (18%)
Similarity:105/307 - (34%) Gaps:87/307 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ALAFNHWLLIPGEKLAQIGDIVQMLHNSSLLIDDIEDNSI-LRRGVPVAHSIYGVAST-INAANY 106
            |.|.:||..:..:....:|.....:....||.|::.:.:| :|:.|...|.:...|.| :|....
 Frog    33 ATAASHWNKVVSDAEKIVGYPTSFMSLRCLLSDELNNIAIQVRKLVGTKHPLLNTARTFVNEKGN 97

  Fly   107 ------ALFLALEKVQQL----DH-----------------PEATKVYTEQLLELHRGQGMEIYW 144
                  .:.|.:.|...|    ||                 .|.|::.....| :|||   .:..
 Frog    98 NRQMRGLVVLLISKAAGLSKSADHMFQPDLASGISARQRSLAEITELIHTAFL-VHRG---IVNI 158

  Fly   145 RDSFTCPSE-SDYKL---MTVRKTGGLFMLA-----------IRLMQLFSSNKEDYSKLTAILGL 194
            .:..||... .|.:.   |.:  ..|.|:||           .:::::.||...|..|     |:
 Frog   159 NELKTCDGPIKDMQFGNKMAI--LSGDFLLANACIGLADLQNAKVVEIVSSAIGDMVK-----GV 216

  Fly   195 YFQIRDDYCNLSLKEYTENKSFAE-----DLTEGKFGFPVIHAVRTQKQDKQVLHILRQRTHDIE 254
            |::          ..|....:|.:     :..|..|   :.|.....|..:..:.:..   ||.|
 Frog   217 YYE----------NSYMPENTFTDVNGISNWMENIF---LSHGSLLAKSCQSAMLLAH---HDSE 265

  Fly   255 VKKYCITLLEKLGSFQYTRKVLESLDAEARSEVARLGSNPYMDRLLN 301
            :..         .:|||.:.:  |:..:..|::....:..|.|.|.:
 Frog   266 ISS---------RAFQYGKHM--SISYKLSSDLQPFINRKYSDSLFS 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 49/271 (18%)
pdss2NP_001008170.1 Isoprenoid_Biosyn_C1 54..389 CDD:381863 52/286 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.