DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and Pdss2

DIOPT Version :9

Sequence 1:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001287138.1 Gene:Pdss2 / 40323 FlyBaseID:FBgn0037044 Length:448 Species:Drosophila melanogaster


Alignment Length:166 Identity:37/166 - (22%)
Similarity:59/166 - (35%) Gaps:57/166 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EELNIILQKTKDKSTQK---EQDEILLQPFTYIQQIPGKQFRSELALA--FN-HWLLIPGEKLAQ 60
            |.:.:|....:|.|..:   |:|| ...|..|   .||...|..|::.  || |.::.|      
  Fly   230 EVVELISSAVRDFSESEFIGERDE-QNNPLPY---KPGTFQRPSLSVGVDFNEHDVMTP------ 284

  Fly    61 IGDIVQMLHNSSLLIDDIEDNSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQLDHPEATK 125
             ..|.|:|.|..   ::.|..:||..|     |:.|.:.                      :|:.
  Fly   285 -MPIAQVLGNPE---EEWECRNILNAG-----SLLGKSC----------------------QASL 318

  Fly   126 VYTEQLLELHR-----GQGMEIYWR-----DSFTCP 151
            ....|..||.|     |:.:.:.|:     :.|.||
  Fly   319 KLAGQSEELQRHAYRFGKHLALAWQACLDAEPFQCP 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 29/135 (21%)
Pdss2NP_001287138.1 Isoprenoid_Biosyn_C1 86..441 CDD:294142 37/166 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469589
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12001
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.