DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and Pdss2

DIOPT Version :10

Sequence 1:NP_523958.2 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_649277.1 Gene:Pdss2 / 40323 FlyBaseID:FBgn0037044 Length:448 Species:Drosophila melanogaster


Alignment Length:166 Identity:37/166 - (22%)
Similarity:59/166 - (35%) Gaps:57/166 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EELNIILQKTKDKSTQK---EQDEILLQPFTYIQQIPGKQFRSELALA--FN-HWLLIPGEKLAQ 60
            |.:.:|....:|.|..:   |:|| ...|..|   .||...|..|::.  || |.::.|      
  Fly   230 EVVELISSAVRDFSESEFIGERDE-QNNPLPY---KPGTFQRPSLSVGVDFNEHDVMTP------ 284

  Fly    61 IGDIVQMLHNSSLLIDDIEDNSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQLDHPEATK 125
             ..|.|:|.|..   ::.|..:||..|     |:.|.:.                      :|:.
  Fly   285 -MPIAQVLGNPE---EEWECRNILNAG-----SLLGKSC----------------------QASL 318

  Fly   126 VYTEQLLELHR-----GQGMEIYWR-----DSFTCP 151
            ....|..||.|     |:.:.:.|:     :.|.||
  Fly   319 KLAGQSEELQRHAYRFGKHLALAWQACLDAEPFQCP 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_523958.2 polyprenyl_synt 21..262 CDD:459773 32/144 (22%)
Pdss2NP_649277.1 Isoprenoid_Biosyn_C1 86..441 CDD:469660 37/166 (22%)

Return to query results.
Submit another query.