DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and Pdss2

DIOPT Version :9

Sequence 1:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_038954836.1 Gene:Pdss2 / 365592 RGDID:1359372 Length:407 Species:Rattus norvegicus


Alignment Length:332 Identity:61/332 - (18%)
Similarity:109/332 - (32%) Gaps:102/332 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GKQFRSELALAFNHWLLIPGEKLAQIGDIVQMLHNSSLLIDDIEDNSI-LRRGVPVAHSIYGVA- 98
            |:..||..     ||..:..|....:|.....:....||.|::.:.:: :|:.|...|.:...| 
  Rat    41 GRSSRSPA-----HWNQVVSEAEKIVGYPASFMSLRCLLSDELSNVAMQVRKLVGTQHPLLTTAR 100

  Fly    99 --------------------------STINAA--NYALFLALEKVQQLDHPEATKVYTEQLLELH 135
                                      ||.|::  ||.:...:...|: :..|.|::....|| :|
  Rat   101 GFVHDSRHNLQLRGLVVLLISKAAGPSTRNSSSQNYDMVSGIYSCQR-NLAEITELIHTALL-VH 163

  Fly   136 RGQGMEIYWRDSFTCPSESDYKLMTVRKTGGLFMLAIRLMQLFSSN---KE-DYSKLTAILGLYF 196
            ||                                 .:.|.:|.||:   |: .:....|:|...|
  Rat   164 RG---------------------------------IVNLSELQSSDGPLKDMKFGNKIAVLSGDF 195

  Fly   197 QIRDDYCNLSLKEYTE----NKSFAEDLTEGKF--------GFPVIHAVRTQKQDKQVLHILRQR 249
            .:.:....|:|.:.|:    ..|...||.:|.:        |.|:...:|.....:|..     .
  Rat   196 LLANACNGLALLQNTKVVELLASALMDLVQGIYQENSASTQGNPIPDDIRISTWKEQTF-----L 255

  Fly   250 THDIEVKKYCITLLEKLGSFQYTRKVLESLDAEARSEVARLGSNPYMDRLLNKLLSWKTSDSASI 314
            :|...:.|.|...:|           |...||..:....:.|.:..|...:|..|.....|.||.
  Rat   256 SHCALLAKSCKAAME-----------LAKHDAAVQDMAFQYGKHMAMSHKINSDLQPFIKDKASD 309

  Fly   315 TQSNQIN 321
            :::..:|
  Rat   310 SKTFNLN 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 50/276 (18%)
Pdss2XP_038954836.1 Isoprenoid_Biosyn_C1 69..>320 CDD:412224 54/299 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.