DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and Fpps

DIOPT Version :9

Sequence 1:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_477380.1 Gene:Fpps / 36209 FlyBaseID:FBgn0025373 Length:419 Species:Drosophila melanogaster


Alignment Length:261 Identity:70/261 - (26%)
Similarity:108/261 - (41%) Gaps:67/261 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FTYIQQ--IP-GKQFRSEL-ALAFNHWLLIPGE-------KLAQ-IGDIVQMLHNSSLLIDDIED 80
            |..:.|  :| ||:.|..| .|.:.:  |:|.:       |||| :|..|:||.:..::.||:.|
  Fly   114 FAQVLQYNVPRGKKNRGILTVLTYKN--LVPTQDLTPENIKLAQYLGWCVEMLQSFFIISDDVMD 176

  Fly    81 NSILRRGVPVAHSIYGVAST-INAA---NYALFLALEK----------VQQLDHPEATKVYTEQL 131
            ||..|||.|..|.:..|..| ||.|   ..|::..|:|          :.:|.| |.|.:.|   
  Fly   177 NSTTRRGQPCWHKVENVGLTAINDALMIENAMYAILKKHFSHLDCYVALMELFH-EITYITT--- 237

  Fly   132 LELHRGQGMEIYWRDSFTCPSE---SDYKLMTVRKTGGL-----FMLAIRLMQLFSSNKEDYSKL 188
                .||.::  ..:|..|.||   .:||.:...||...     |.||:.|.....:.....||.
  Fly   238 ----CGQSLD--QLNSNRCVSEFTMENYKAIVENKTAYYSFYLPFALALHLAGYKDAEAFRQSKT 296

  Fly   189 TAI-LGLYFQIRDDYCNLSLKEYTENKSFAEDLTEGKFG----------FPVIHAVRTQKQDKQV 242
            ..: :|.:||::||:.:          .|......||.|          ..|:...|...:.||:
  Fly   297 ILLEMGNFFQVQDDFLD----------CFGNPEVTGKIGTDIQDNKCSWLAVVAMQRANVEQKQI 351

  Fly   243 L 243
            :
  Fly   352 M 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 69/259 (27%)
FppsNP_477380.1 polyprenyl_synt 119..377 CDD:278763 69/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.