DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and ggps1

DIOPT Version :9

Sequence 1:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001278689.1 Gene:ggps1 / 336798 ZFINID:ZDB-GENE-030131-8742 Length:350 Species:Danio rerio


Alignment Length:307 Identity:172/307 - (56%)
Similarity:229/307 - (74%) Gaps:2/307 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DKSTQKEQDEILLQPFTYIQQIPGKQFRSELALAFNHWLLIPGEKLAQIGDIVQMLHNSSLLIDD 77
            |:..:...:.|||:|:.|:.|:||||.|::|:.||||||.:|.:||..|.::.:||||:||||||
Zfish    43 DEKQRATSERILLEPYKYLLQLPGKQVRTKLSQAFNHWLNVPEDKLQVIIEVTEMLHNASLLIDD 107

  Fly    78 IEDNSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQLDHPEATKVYTEQLLELHRGQGMEI 142
            |||:|.||||.||||||||:.|.||:|||..||.||||..|:||||.:|:|.||||||||||::|
Zfish   108 IEDSSKLRRGFPVAHSIYGIPSVINSANYVYFLGLEKVLMLEHPEAVRVFTRQLLELHRGQGLDI 172

  Fly   143 YWRDSFTCPSESDYKLMTVRKTGGLFMLAIRLMQLFSSNKEDYSKLTAILGLYFQIRDDYCNLSL 207
            :|||::|||||::|:.|.::||||||.||:.||||||..|.|...|...|||||||||||.||:.
Zfish   173 HWRDTYTCPSEAEYRAMVLQKTGGLFGLAVGLMQLFSDWKRDLKPLLDTLGLYFQIRDDYANLNS 237

  Fly   208 KEYTENKSFAEDLTEGKFGFPVIHAVRTQKQDKQVLHILRQRTHDIEVKKYCITLLEKLGSFQYT 272
            |||:.||||.||||||||.||.|||:.:..:..||.:||||||.::::|:||:..|||:|||.||
Zfish   238 KEYSANKSFCEDLTEGKFSFPTIHAIWSHPESTQVQNILRQRTENLDIKRYCVDYLEKVGSFAYT 302

  Fly   273 RKVLESLDAEARSEVARLGSNPYMDRLLNKL--LSWKTSDSASITQS 317
            |:.|..|:.||...:..||.||.::.|:..|  :..:....|:::||
Zfish   303 RQTLLDLEVEAYRLIKELGGNPELEALVEHLSRMYKEPEGGATVSQS 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 148/236 (63%)
ggps1NP_001278689.1 polyprenyl_synt 59..297 CDD:278763 148/237 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595511
Domainoid 1 1.000 319 1.000 Domainoid score I1217
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31267
Inparanoid 1 1.050 358 1.000 Inparanoid score I2184
OMA 1 1.010 - - QHG62161
OrthoDB 1 1.010 - - D458107at33208
OrthoFinder 1 1.000 - - FOG0007302
OrthoInspector 1 1.000 - - oto40148
orthoMCL 1 0.900 - - OOG6_103487
Panther 1 1.100 - - LDO PTHR12001
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2131
SonicParanoid 1 1.000 - - X7
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.