DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and PDSS1

DIOPT Version :9

Sequence 1:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_055132.2 Gene:PDSS1 / 23590 HGNCID:17759 Length:415 Species:Homo sapiens


Alignment Length:248 Identity:55/248 - (22%)
Similarity:111/248 - (44%) Gaps:22/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 IVQMLHNSSLLIDDIEDNSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQLDHPEATKVYT 128
            |.:|:|.:||:.||:.|::..|||....:.|:|....:.|.:..|..|...:.::.:.....:.|
Human   168 IAEMIHTASLVHDDVIDDASSRRGKHTVNKIWGEKKAVLAGDLILSAASIALARIGNTTVISILT 232

  Fly   129 EQLLELHRGQGMEIYWRDSFTCPSESD----YKLMTVRKTGGLFMLAIRLMQLFSSNKE------ 183
            :.:.:|.||:.:::..::     :|::    |...|.:||..|...:.:.:.:......      
Human   233 QVIEDLVRGEFLQLGSKE-----NENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVHEIA 292

  Fly   184 -DYSKLTAILGLYFQIRDDYCNLSLKEYTENKSFAEDLTEGKFGFPVIHAVRTQKQDKQVLHILR 247
             .|.|   .:|:.||:.||..:.:.......|..:.||..|....||:.|  .|:..:....|:|
Human   293 YQYGK---NVGIAFQLIDDVLDFTSCSDQMGKPTSADLKLGLATGPVLFA--CQQFPEMNAMIMR 352

  Fly   248 QRTHDIEVKKYCITLLEKLGSFQYTRKVLESLDAEARSEVARLGSNPYMDRLL 300
            :.:...:|.:....:|:..| .|.|..:.:....||..|:::|..:|..|.|:
Human   353 RFSLPGDVDRARQYVLQSDG-VQQTTYLAQQYCHEAIREISKLRPSPERDALI 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 45/213 (21%)
PDSS1NP_055132.2 PLN02890 6..415 CDD:178478 55/248 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..35
Isoprenoid_Biosyn_C1 102..413 CDD:294142 55/248 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.