DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and coq-1

DIOPT Version :9

Sequence 1:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_491588.1 Gene:coq-1 / 172190 WormBaseID:WBGene00000761 Length:393 Species:Caenorhabditis elegans


Alignment Length:266 Identity:65/266 - (24%)
Similarity:114/266 - (42%) Gaps:27/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 QIGDIVQMLHNSSLLIDDIEDNSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQLDHPEAT 124
            :||.|.:|:|.:||:.||:.|.:..|||....::::|...::...::.|..|.:.:..:..|...
 Worm   137 KIGMIAEMIHTASLVHDDVIDEANTRRGSASVNAVWGNKMSVLVGDFILARATQILCSIGKPNII 201

  Fly   125 KVYTEQLLELHRGQGMEIYWRDSFTCPSESD-------YKLMTVRKTGGLFMLAIRLMQLFSSNK 182
            .|....:.:|..|:.|::     .|.|:::.       |...|.|||..||..:.|...:.:...
 Worm   202 SVMASIIEDLVLGEFMQM-----STTPTDATPVDRMKAYIEKTHRKTASLFASSCRSAAILADGS 261

  Fly   183 EDYSKLTAI-------LGLYFQIRDDYCNLSLKEYTENKSFAEDLTEGKFGFPVIHAVRTQKQDK 240
            :  .||..|       ||:.||:.||..:.........|..|.||..|....||::|.....:..
 Worm   262 D--LKLHEIAFEYGRNLGIAFQLADDLLDFIATADEMGKPVAADLKLGLATAPVLYACEQYPELN 324

  Fly   241 QVLHILRQRTHDIEVKKYCITLLEKLGSFQYTRKVLESLDAEARSEVARLGSNPYMDRLLNKLLS 305
            .:|  ||:..||.:.:|....::...| ...||::::|...:|   |....|.|..:.....|:.
 Worm   325 TML--LRKFKHDGDAEKAREIVVNSDG-MDKTRRLIDSYSQKA---VEMASSLPNRNESTEHLIK 383

  Fly   306 WKTSDS 311
            ...|.|
 Worm   384 LAMSQS 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 54/220 (25%)
coq-1NP_491588.1 polyprenyl_synt 80..344 CDD:278763 54/215 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1150
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.