DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and Fdps

DIOPT Version :9

Sequence 1:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001240680.1 Gene:Fdps / 110196 MGIID:104888 Length:420 Species:Mus musculus


Alignment Length:244 Identity:60/244 - (24%)
Similarity:98/244 - (40%) Gaps:45/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLQPFTYIQQIPGKQFRSELALAFNHWLLIPGEKLAQIGDIVQMLHNSSLLIDDIEDNSILRRGV 88
            ::|.|..:.: |.||....|            ::...:|..|::|....|:.|||.|:|:.|||.
Mouse   131 VVQAFQELVE-PKKQDAESL------------QRALTVGWCVELLQAFFLVSDDIMDSSLTRRGQ 182

  Fly    89 PVAHSIYGVASTINAANYALFLALEKVQQLDHPEATKVYTEQLLEL--------HRGQGMEIYWR 145
            ...:...|:.  ::|.|.||.|.....:.|......:.|...||||        ..||.:     
Mouse   183 ICWYQKPGIG--LDAINDALLLEASIYRLLKFYCREQPYYLNLLELFLQSSYQTEIGQTL----- 240

  Fly   146 DSFTCP---------SESDYKLMTVRKTG----GLFMLAIRLMQLFSSNKEDYSKLTAI--LGLY 195
            |..|.|         :|..||.:...||.    .|.:.|...|......||..:.|..:  :|.:
Mouse   241 DLMTAPQGHVDLGRYTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANALKILMEMGEF 305

  Fly   196 FQIRDDYCNLSLKEYTENKSFAEDLTEGKFGFPVIHA-VRTQKQDKQVL 243
            ||::|||.:| ..:.:.......|:.:.|..:.|:.. :|...|.:|:|
Mouse   306 FQVQDDYLDL-FGDPSVTGKVGTDIQDNKCSWLVVQCLLRASPQQRQIL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 58/238 (24%)
FdpsNP_001240680.1 MSP1_C 72..>144 CDD:284802 3/13 (23%)
polyprenyl_synt 117..378 CDD:278763 60/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.