DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qm and Pdss1

DIOPT Version :9

Sequence 1:NP_001163370.1 Gene:qm / 38816 FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_003751782.2 Gene:Pdss1 / 100364990 RGDID:2319976 Length:500 Species:Rattus norvegicus


Alignment Length:327 Identity:68/327 - (20%)
Similarity:134/327 - (40%) Gaps:42/327 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EELNIILQKTKDKSTQKEQDEILLQPFTYIQQIPGKQFRS----ELALAFNHWLLIPGEKLAQ-- 60
            :||:|..::.||.|             .|.....||.||.    .:|.|.|.......|..|:  
  Rat   197 KELHISTRELKDMS-------------EYYFDGKGKAFRPIIVVLMARACNIHHNNSREMQARQR 248

  Fly    61 -IGDIVQMLHNSSLLIDDIEDNSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQLDHPEAT 124
             :..:.:|:|.::|:.||:.|::..|||....:.::|....:.|.:..|..|...:.::.:....
  Rat   249 SVALVAEMIHTATLVHDDVIDDASSRRGKHTVNKVWGEQKAVLAGDLILSAASIALARIGNTAVV 313

  Fly   125 KVYTEQLLELHRGQGMEIYWRDSFTCPSESD----YKLMTVRKTGGLFMLAIRLMQLFSSNKE-- 183
            .:..:.:.:|.||:.:::..::     :|::    |...|.:||..|...:.:.:.:......  
  Rat   314 SLLAQVIEDLVRGEFLQLGSKE-----NENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVV 373

  Fly   184 -----DYSKLTAILGLYFQIRDDYCNLSLKEYTENKSFAEDLTEGKFGFPVIHAVRTQKQDKQVL 243
                 .|.|   .:|:.||:.||..:.:.......|..:.||..|....||:.|  .|:..:...
  Rat   374 HEIAYQYGK---NVGIAFQLIDDVLDFTSCSDQMGKPTSADLKLGIATGPVLFA--CQQFPEMNA 433

  Fly   244 HILRQRTHDIEVKKYCITLLEKLGSFQYTRKVLESLDAEARSEVARLGSNPYMDRLLNKLLSWKT 308
            .|:|:.:...:|.:....:|:..| .|.|..:.:....:|..|:.:|..:...|.|:....|..|
  Rat   434 MIMRRFSLPGDVDRARQYVLQSDG-VQQTTYLAQQYCHKAVREIRKLRPSTERDALIQLSESVLT 497

  Fly   309 SD 310
            .|
  Rat   498 RD 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 51/254 (20%)
Pdss1XP_003751782.2 PLN02890 74..500 CDD:178478 68/327 (21%)
Isoprenoid_Biosyn_C1 191..498 CDD:294142 66/324 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.