DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp19 and SEC65

DIOPT Version :9

Sequence 1:NP_477135.2 Gene:Srp19 / 38815 FlyBaseID:FBgn0015298 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_013602.1 Gene:SEC65 / 854866 SGDID:S000004573 Length:273 Species:Saccharomyces cerevisiae


Alignment Length:144 Identity:37/144 - (25%)
Similarity:60/144 - (41%) Gaps:35/144 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPSMKHNDME---RWICIYPAYINRKKTRQEGRRLPKENCVDNPSYIEIRDVLSVSNLQFLMENK 73
            |.::...|:|   |:..:||.|.:..::.:||||:|||..|:||....:.|.:....:..:.|.:
Yeast    84 SEAISKKDLEEVKRFQVLYPCYFDINRSHKEGRRVPKELAVENPLAKTMADAVRELGILCIFEGE 148

  Fly    74 KYC---------------REN----SSEMEFRGRVRVQLRNVDGTLYNNDFPTRESIMLHIA--- 116
            | |               :||    .:..:|:|..| ||....|. |....||....:..|.   
Yeast   149 K-CHPQDFGNPGRIRVLFKENGQLIGAATKFKGGKR-QLMKAVGE-YMKRHPTTIESLREIPYGP 210

  Fly   117 -------SKIPQLK 123
                   .|||::|
Yeast   211 DFDNIEFKKIPRVK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp19NP_477135.2 SRP19 25..122 CDD:280156 32/125 (26%)
SEC65NP_013602.1 SRP19 100..196 CDD:396484 26/98 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345015
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1400
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003563
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101284
Panther 1 1.100 - - LDO PTHR17453
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4771
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.730

Return to query results.
Submit another query.