DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp19 and SEC65

DIOPT Version :10

Sequence 1:NP_477135.2 Gene:Srp19 / 38815 FlyBaseID:FBgn0015298 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_013602.1 Gene:SEC65 / 854866 SGDID:S000004573 Length:273 Species:Saccharomyces cerevisiae


Alignment Length:144 Identity:37/144 - (25%)
Similarity:60/144 - (41%) Gaps:35/144 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPSMKHNDME---RWICIYPAYINRKKTRQEGRRLPKENCVDNPSYIEIRDVLSVSNLQFLMENK 73
            |.::...|:|   |:..:||.|.:..::.:||||:|||..|:||....:.|.:....:..:.|.:
Yeast    84 SEAISKKDLEEVKRFQVLYPCYFDINRSHKEGRRVPKELAVENPLAKTMADAVRELGILCIFEGE 148

  Fly    74 KYC---------------REN----SSEMEFRGRVRVQLRNVDGTLYNNDFPTRESIMLHIA--- 116
            | |               :||    .:..:|:|..| ||....|. |....||....:..|.   
Yeast   149 K-CHPQDFGNPGRIRVLFKENGQLIGAATKFKGGKR-QLMKAVGE-YMKRHPTTIESLREIPYGP 210

  Fly   117 -------SKIPQLK 123
                   .|||::|
Yeast   211 DFDNIEFKKIPRVK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp19NP_477135.2 SRP19 25..122 CDD:460383 32/125 (26%)
SEC65NP_013602.1 SRP19 100..196 CDD:460383 26/98 (27%)

Return to query results.
Submit another query.