DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp19 and AT1G48160

DIOPT Version :9

Sequence 1:NP_477135.2 Gene:Srp19 / 38815 FlyBaseID:FBgn0015298 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001323146.1 Gene:AT1G48160 / 841235 AraportID:AT1G48160 Length:145 Species:Arabidopsis thaliana


Alignment Length:143 Identity:55/143 - (38%)
Similarity:76/143 - (53%) Gaps:6/143 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DMERWICIYPAYINRKKTRQEGRRLPKENCVDNPSYIEIRDVLSVSNLQFLME-NKKYCRENSSE 82
            ::::|:.|||.|||.|||..||||:......:||:.|||.|......|...:| :|.|.|:....
plant     7 NIKKWVVIYPVYINSKKTVAEGRRISVSKSCENPNCIEISDCCKHLKLPSAVEIDKAYPRDFMQV 71

  Fly    83 MEFRGRVRVQLRNVDGTLYNNDFPTRESIMLHIASKIPQLKTRQNKSGDSYHQQSQPQSNASGSG 147
                |||||||:..||||.|....:|:.:|..||..:|:...|..|......::.:||:..|.||
plant    72 ----GRVRVQLKREDGTLLNPAITSRKHLMQKIAELVPRHPERVKKQEAQKAKKQEPQATTSTSG 132

  Fly   148 -GGGGGKKGKGKR 159
             ....||.||.||
plant   133 TSSKSGKGGKKKR 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp19NP_477135.2 SRP19 25..122 CDD:280156 41/97 (42%)
AT1G48160NP_001323146.1 SRP19 13..107 CDD:396484 41/97 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I3606
eggNOG 1 0.900 - - E1_COG1400
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2361
Inparanoid 1 1.050 86 1.000 Inparanoid score I2329
OMA 1 1.010 - - QHG55727
OrthoDB 1 1.010 - - D1552706at2759
OrthoFinder 1 1.000 - - FOG0003563
OrthoInspector 1 1.000 - - oto2930
orthoMCL 1 0.900 - - OOG6_101284
Panther 1 1.100 - - LDO PTHR17453
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3986
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.