DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp19 and Srp19

DIOPT Version :9

Sequence 1:NP_477135.2 Gene:Srp19 / 38815 FlyBaseID:FBgn0015298 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_079803.2 Gene:Srp19 / 66384 MGIID:1913634 Length:144 Species:Mus musculus


Alignment Length:152 Identity:75/152 - (49%)
Similarity:98/152 - (64%) Gaps:19/152 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPSMKHNDMERWICIYPAYINRKKTRQEGRRLPKENCVDNPSYIEIRDVLSVSNLQ-FLMENKKY 75
            ||:    |.:|:|||||||:|.|||..||||:|....|:||:..||:||.|...|. ||.:||.|
Mouse     8 SPA----DQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNAFLEKNKMY 68

  Fly    76 CRENSSEMEFRGRVRVQLRNVDGTLYNNDFPTRESIMLHIASKIPQLKTRQNKSG--DSYHQQSQ 138
            .||.:.:::|||||||||:..||:|....||:|:|:||::|..||:||||..|||  |...||  
Mouse    69 SREWNRDVQFRGRVRVQLKQEDGSLCLVQFPSRKSVMLYVAEMIPKLKTRTQKSGGADPSLQQ-- 131

  Fly   139 PQSNASGSGGGGGGKKGKGKRR 160
                      |.|.||||||::
Mouse   132 ----------GEGSKKGKGKKK 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp19NP_477135.2 SRP19 25..122 CDD:280156 52/97 (54%)
Srp19NP_079803.2 SRP19 17..115 CDD:307852 52/98 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844457
Domainoid 1 1.000 101 1.000 Domainoid score I6946
eggNOG 1 0.900 - - E1_COG1400
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2361
Inparanoid 1 1.050 128 1.000 Inparanoid score I4649
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55727
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003563
OrthoInspector 1 1.000 - - oto92516
orthoMCL 1 0.900 - - OOG6_101284
Panther 1 1.100 - - LDO PTHR17453
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4771
SonicParanoid 1 1.000 - - X3986
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.