DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp19 and srp19

DIOPT Version :9

Sequence 1:NP_477135.2 Gene:Srp19 / 38815 FlyBaseID:FBgn0015298 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001011122.1 Gene:srp19 / 496535 XenbaseID:XB-GENE-5919686 Length:142 Species:Xenopus tropicalis


Alignment Length:145 Identity:68/145 - (46%)
Similarity:92/145 - (63%) Gaps:11/145 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 HNDMERWICIYPAYINRKKTRQEGRRLPKENCVDNPSYIEIRDVLSVSNLQFLME-NKKYCRENS 80
            |..::|:|||||||:|.|||..||||:|.|..|.||:..||.|:...:.|..::| :|.|.||.:
 Frog     8 HASVDRFICIYPAYLNSKKTIAEGRRIPIEKAVQNPTCSEIADICRANKLNAVVEGDKMYTREWN 72

  Fly    81 SEMEFRGRVRVQLRNVDGTLYNNDFPTRESIMLHIASKIPQLKTRQNKSGDSYHQQSQPQSNASG 145
            .:.:|||||||||||.||:...:...:|::|||.:|.:||:||||..|||..  .||..|     
 Frog    73 RDTQFRGRVRVQLRNEDGSSCVDKLSSRKAIMLRVAEEIPKLKTRTQKSGGG--DQSAQQ----- 130

  Fly   146 SGGGGGGKKGKGKRR 160
               |.||||.|.|::
 Frog   131 ---GEGGKKNKKKKK 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp19NP_477135.2 SRP19 25..122 CDD:280156 48/97 (49%)
srp19NP_001011122.1 SRP19 16..114 CDD:376664 48/97 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 95 1.000 Domainoid score I7299
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2361
Inparanoid 1 1.050 121 1.000 Inparanoid score I4613
OMA 1 1.010 - - QHG55727
OrthoDB 1 1.010 - - D1552706at2759
OrthoFinder 1 1.000 - - FOG0003563
OrthoInspector 1 1.000 - - oto102817
Panther 1 1.100 - - LDO PTHR17453
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3986
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.