DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp19 and sec65

DIOPT Version :9

Sequence 1:NP_477135.2 Gene:Srp19 / 38815 FlyBaseID:FBgn0015298 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_588458.2 Gene:sec65 / 2539061 PomBaseID:SPCC126.15c Length:213 Species:Schizosaccharomyces pombe


Alignment Length:38 Identity:13/38 - (34%)
Similarity:22/38 - (57%) Gaps:1/38 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ICIYPAYINRKKTRQEGRRLPKENCVDNPSYIEIRDVL 61
            |.:||.|.::.:.|: .|.:||:..:.||....|.||:
pombe    18 IILYPIYFDKSRPRR-FRCVPKDKAILNPLAKNIADVV 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp19NP_477135.2 SRP19 25..122 CDD:280156 12/37 (32%)
sec65NP_588458.2 SRP19 19..100 CDD:280156 12/37 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1400
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003563
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101284
Panther 1 1.100 - - LDO PTHR17453
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4771
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.