powered by:
Protein Alignment Srp19 and sec65
DIOPT Version :9
Sequence 1: | NP_477135.2 |
Gene: | Srp19 / 38815 |
FlyBaseID: | FBgn0015298 |
Length: | 160 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_588458.2 |
Gene: | sec65 / 2539061 |
PomBaseID: | SPCC126.15c |
Length: | 213 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 38 |
Identity: | 13/38 - (34%) |
Similarity: | 22/38 - (57%) |
Gaps: | 1/38 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 ICIYPAYINRKKTRQEGRRLPKENCVDNPSYIEIRDVL 61
|.:||.|.::.:.|: .|.:||:..:.||....|.||:
pombe 18 IILYPIYFDKSRPRR-FRCVPKDKAILNPLAKNIADVV 54
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Srp19 | NP_477135.2 |
SRP19 |
25..122 |
CDD:280156 |
12/37 (32%) |
sec65 | NP_588458.2 |
SRP19 |
19..100 |
CDD:280156 |
12/37 (32%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1400 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003563 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_101284 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR17453 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R4771 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.930 |
|
Return to query results.
Submit another query.