DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp19 and sec65

DIOPT Version :10

Sequence 1:NP_477135.2 Gene:Srp19 / 38815 FlyBaseID:FBgn0015298 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_588458.3 Gene:sec65 / 2539061 PomBaseID:SPCC126.15C Length:199 Species:Schizosaccharomyces pombe


Alignment Length:38 Identity:13/38 - (34%)
Similarity:22/38 - (57%) Gaps:1/38 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ICIYPAYINRKKTRQEGRRLPKENCVDNPSYIEIRDVL 61
            |.:||.|.::.:.|: .|.:||:..:.||....|.||:
pombe     4 IILYPIYFDKSRPRR-FRCVPKDKAILNPLAKNIADVV 40

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp19NP_477135.2 SRP19 25..122 CDD:460383 12/37 (32%)
sec65NP_588458.3 SRP19 5..86 CDD:460383 12/37 (32%)

Return to query results.
Submit another query.