DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp19 and F37F2.2

DIOPT Version :9

Sequence 1:NP_477135.2 Gene:Srp19 / 38815 FlyBaseID:FBgn0015298 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_490855.3 Gene:F37F2.2 / 171711 WormBaseID:WBGene00018159 Length:142 Species:Caenorhabditis elegans


Alignment Length:143 Identity:59/143 - (41%)
Similarity:86/143 - (60%) Gaps:11/143 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NDMERWICIYPAYINRKKTRQEGRRLPKENCVDNPSYIEIRDVLSVSNLQFLMENKK-YCRENSS 81
            :..:|||.||||||::|||.::||::.:...|:||:.:||.|||:......|:|..| |.|:...
 Worm    10 SSQKRWIVIYPAYIDKKKTAKQGRKISQILAVENPTSVEIHDVLAAVGFNPLLERTKCYPRDGER 74

  Fly    82 EMEFRGRVRVQLRNVDGTLYNNDFPTRESIMLHIASKIPQLKTRQNKSGDSYHQQSQPQSNASGS 146
            :.|.:|||||||:|.|||. .::..||:.|...:|..||:|||||    ..|...|...|:|:.:
 Worm    75 DFEVQGRVRVQLKNDDGTA-KHEQKTRDEIFKMVAEMIPKLKTRQ----PGYTAPSVASSSAAAA 134

  Fly   147 GGGGGGKKGKGKR 159
                 |||.|.|:
 Worm   135 -----GKKNKKKK 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp19NP_477135.2 SRP19 25..122 CDD:280156 42/97 (43%)
F37F2.2NP_490855.3 SRP19 17..114 CDD:280156 42/97 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163394
Domainoid 1 1.000 79 1.000 Domainoid score I5672
eggNOG 1 0.900 - - E1_COG1400
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2361
Inparanoid 1 1.050 99 1.000 Inparanoid score I3594
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55727
OrthoDB 1 1.010 - - D1552706at2759
OrthoFinder 1 1.000 - - FOG0003563
OrthoInspector 1 1.000 - - oto18721
orthoMCL 1 0.900 - - OOG6_101284
Panther 1 1.100 - - LDO PTHR17453
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4771
SonicParanoid 1 1.000 - - X3986
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.