DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eco and RAD30

DIOPT Version :9

Sequence 1:NP_648106.1 Gene:eco / 38812 FlyBaseID:FBgn0035766 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_010707.3 Gene:RAD30 / 852028 SGDID:S000002827 Length:632 Species:Saccharomyces cerevisiae


Alignment Length:342 Identity:71/342 - (20%)
Similarity:119/342 - (34%) Gaps:97/342 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SRLRQINDDEDDADVDSLGVLPLKTHVAANRKGRSLFAAVPGKSSSSANSSP--ETNKENKKTRG 93
            ::::|.:.|...:::|     ||||...|.:    ||....|:.....:|.|  ::...||..||
Yeast   348 AKVKQSDYDRSTSNID-----PLKTADLAEK----LFKLSRGRYGLPLSSRPVVKSMMSNKNLRG 403

  Fly    94 GVMTATAEQLP--QLFTA--TMRLNSNSSSNSRNSSPRQTRVQRKRADSSMSSPTSSSE-----G 149
            ....:..:.:.  ::|.|  |.|:.......::...||..         |:|..|.|.|     |
Yeast   404 KSCNSIVDCISWLEVFCAELTSRIQDLEQEYNKIVIPRTV---------SISLKTKSYEVYRKSG 459

  Fly   150 TPSSRARNSIRRSPRTFSAQKDPDAFSSPESFQTRLSKVAAMLMKGQDSR--SMLEKSKKKHNHS 212
            ..:.:..|                 |.|.|..:..:..|..:.:||::..  .:.:.|....|..
Yeast   460 PVAYKGIN-----------------FQSHELLKVGIKFVTDLDIKGKNKSYYPLTKLSMTITNFD 507

  Fly   213 L----KTTA-----QVHTTKPKKTSPAEESQSDDEKPSSSKNSRKNTEVRETRSSQIISPKTRNR 268
            :    ||..     ||||.|      :...:.|:||.:|||...|             :||....
Yeast   508 IIDLQKTVVDMFGNQVHTFK------SSAGKEDEEKTTSSKADEK-------------TPKLECC 553

  Fly   269 RRPFTSADINCKTLKAAAHLHENMRSYDEEKTAAVKL--------ENSRSRSKSPVEVFKSNDDA 325
            :...|..|  .|.|:..|..|           .|:||        |:|::.|.....:..|....
Yeast   554 KYQVTFTD--QKALQEHADYH-----------LALKLSEGLNGAEESSKNLSFGEKRLLFSRKRP 605

  Fly   326 VKRNTGNTNNKTAKSSE 342
            ..::|.....|...||:
Yeast   606 NSQHTATPQKKQVTSSK 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecoNP_648106.1 zf-C2H2_3 839..878 CDD:290589
NAT_SF 945..>1008 CDD:173926
Acetyltransf_13 982..1043 CDD:290591
RAD30NP_010707.3 PolY_Pol_eta 27..505 CDD:176456 37/191 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4551
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.