DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eco and ECO1

DIOPT Version :9

Sequence 1:NP_648106.1 Gene:eco / 38812 FlyBaseID:FBgn0035766 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_116683.1 Gene:ECO1 / 850584 SGDID:S000001923 Length:281 Species:Saccharomyces cerevisiae


Alignment Length:265 Identity:66/265 - (24%)
Similarity:114/265 - (43%) Gaps:73/265 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   838 NQYQIDAGQKAFGARQCQQCGLVYTVHEPEEELLHREYH------------------------NS 878
            ::.|::.|.|:....:|.:|.:.|:....|:..:|.:||                        .:
Yeast    19 SKLQVNNGSKSNKIVKCDKCEMSYSSTSIEDRAIHEKYHTLQLHGRKWSPNWGSIVYTERNHSRT 83

  Fly   879 IHVLRFKGWI------------------DEDIVSVYPEWASDGRIIRINERAPTARLDRLRDLIG 925
            :|:.|..|.|                  :|.||.|.|: .|:|.:     ||.|       :::.
Yeast    84 VHLSRSTGTITPLNSSPLKKSSPSITHQEEKIVYVRPD-KSNGEV-----RAMT-------EIMT 135

  Fly   926 VVDKELG--------YSSYIVPKIFVAFIAVRKQQIVGFCLVQPL-------SQAHRFIQVDGTD 975
            :|:.||.        ::|....| ..||:.:|..:.||..:::.|       |...|::..| :.
Yeast   136 LVNNELNAPHDENVIWNSTTEEK-GKAFVYIRNDRAVGIIIIENLYGGNGKTSSRGRWMVYD-SR 198

  Fly   976 YFSEESYP-ASCGVSRIWVSPLQRRSGIASKLLRVVQCHTVLGQEIARECIAFSTPTDDGRALAR 1039
            ...:..|| ...|:|||||....|:.|||:||:.|.:.:.|.|:.|.|..:|:|.|||.|..||.
Yeast   199 RLVQNVYPDFKIGISRIWVCRTARKLGIATKLIDVARENIVYGEVIPRYQVAWSQPTDSGGKLAS 263

  Fly  1040 QFTGL 1044
            ::.|:
Yeast   264 KYNGI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecoNP_648106.1 zf-C2H2_3 839..878 CDD:290589 10/62 (16%)
NAT_SF 945..>1008 CDD:173926 22/70 (31%)
Acetyltransf_13 982..1043 CDD:290591 27/61 (44%)
ECO1NP_116683.1 zf-C2H2_3 18..57 CDD:404719 8/37 (22%)
Acetyltransf_13 209..267 CDD:404721 25/57 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I2848
eggNOG 1 0.900 - - E1_KOG3014
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5634
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002145
OrthoInspector 1 1.000 - - oto99486
orthoMCL 1 0.900 - - OOG6_102667
Panther 1 1.100 - - LDO PTHR45884
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4551
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.