DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and AtRZ-1b

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_564759.1 Gene:AtRZ-1b / 842359 AraportID:AT1G60650 Length:292 Species:Arabidopsis thaliana


Alignment Length:327 Identity:91/327 - (27%)
Similarity:120/327 - (36%) Gaps:102/327 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDIV--------RNYGFVHLDCVGDV 132
            |.|.......::||||.|:......::...|.:||.:.||.|:        |.:||:........
plant     2 KDRENDGNLESRIFVGGLSWDVTERQLESTFDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGA 66

  Fly   133 QDAIKELNGRVVDGQPLKVQVSTSRVRPK-----------------PGMGDPEQCYRCGRSGHWS 180
            .||||.::||.:..   || :|.::..||                 .|.|..::|::|.|.|||:
plant    67 DDAIKHMHGRELGN---KV-ISVNKAEPKVGGEDVDQLKKGGGYSSRGKGTEDECFKCRRPGHWA 127

  Fly   181 KECPRLYGSAGGGREP-PSPLS-------AGGYRDRMYGRDPYPPPPPPPPFLRDRIMDGFRD-- 235
            ::||    |.|..||. ..||:       ..|:|||...||..........|  ||.|||.||  
plant   128 RDCP----STGDDRERFRVPLAMRSRIGDIDGHRDRYGDRDLEREREREREF--DRYMDGRRDRD 186

  Fly   236 ---YDYYDRRFEDSRDLYERRYQTSRMRDFPPPPISRREPMPLPPTLSGSLRSCSVSRGYDTMFS 297
               |.|.||  .||.|.||       .||..|                               |.
plant   187 GGRYSYRDR--FDSGDKYE-------PRDHYP-------------------------------FE 211

  Fly   298 RRSPPPPRSSNGMSRYGSPTPH------GYE-DFSRDAFDERMISSRGMRGP-SPPGRRY----A 350
            |.:||..|..:  .|||.|..|      |.| .:.||.:........|..|| ...||.|    .
plant   212 RYAPPGDRFVS--DRYGMPEHHLENEYRGRERSYDRDRYARDTSDRYGDMGPIRDEGRPYRSRPG 274

  Fly   351 PY 352
            ||
plant   275 PY 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 21/72 (29%)
hnRNP-R-Q <88..>258 CDD:273732 64/207 (31%)
AtRZ-1bNP_564759.1 RRM 13..85 CDD:214636 22/75 (29%)
zf-CCHC 117..132 CDD:395050 8/18 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2389
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.