DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and RBM4B

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_113680.1 Gene:RBM4B / 83759 HGNCID:28842 Length:359 Species:Homo sapiens


Alignment Length:347 Identity:114/347 - (32%)
Similarity:169/347 - (48%) Gaps:75/347 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLFIGNLDEKTQATELRALFEKYGTVVECDVVKNYGFVHMETEQQGRDAIQNLNGYTLNEFAIKV 72
            |||||||..:....|:|:|||:||.|:|||::|||||||:|.:....|||:||:.|.|:...|.|
Human     3 KLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINV 67

  Fly    73 EAAKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRNYGFVHLDCVGDVQDAIK 137
            ||:|::   :..:||:.|||::......|:|..|::||.|:|||||::|.|||::...|..:||:
Human    68 EASKNK---SKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIR 129

  Fly   138 ELNGRVVDGQPLKVQVSTSRVRPKPGMGDPEQCYRCGRSGHWSKECP-----------RLYGSAG 191
            .|:.....|:.:.||:||||:|..|||||...|||||:.||||||||           ..|....
Human   130 GLDNTEFQGKRMHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPVDRTGRVADFTEQYNEQY 194

  Fly   192 GGREPPSPLSAGGYRDRMYGRDPYPPPPPPPPFLRDRIMDGFRDYDYYDRRFEDSRDLYERRYQT 256
            |....|..:   ||.:.||..|.|..                  .|||            :||  
Human   195 GAVRTPYTM---GYGESMYYNDAYGA------------------LDYY------------KRY-- 224

  Fly   257 SRMRDFPPPPISRREPMPLPPTLSGSLRSCSVSRGYDTMFSRRSPPPPRSSNGMSRYGSPTPHGY 321
             |:|.:.                  ::.:.:.:..|:......|..|...|..::.:.:.|    
Human   225 -RVRSYE------------------AVAAAAAASAYNYAEQTMSHLPQVQSTTVTSHLNST---- 266

  Fly   322 EDFSRDAFDERMISSRGMRGPS 343
               |.|.:|..::.:.|....|
Human   267 ---SVDPYDRHLLPNSGAAATS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 34/64 (53%)
RRM1_2_CoAA_like 87..152 CDD:409779 24/64 (38%)
hnRNP-R-Q <88..>258 CDD:273732 62/180 (34%)
RBM4BNP_113680.1 RRM1_RBM4 2..68 CDD:410018 34/64 (53%)
RRM2_RBM4 78..144 CDD:410019 25/65 (38%)
PTZ00368 <145..>181 CDD:173561 23/35 (66%)
ZnF_C2HC 161..176 CDD:197667 11/14 (79%)
Interaction with TNPO3. /evidence=ECO:0000250 196..359 24/151 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9137
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3876
Isobase 1 0.950 - 0 Normalized mean entropy S3124
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1563362at2759
OrthoFinder 1 1.000 - - FOG0002310
OrthoInspector 1 1.000 - - otm40448
orthoMCL 1 0.900 - - OOG6_104638
Panther 1 1.100 - - LDO PTHR23147
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4630
SonicParanoid 1 1.000 - - X1736
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.950

Return to query results.
Submit another query.