DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and SR30

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_172386.3 Gene:SR30 / 837433 AraportID:AT1G09140 Length:268 Species:Arabidopsis thaliana


Alignment Length:289 Identity:78/289 - (26%)
Similarity:106/289 - (36%) Gaps:68/289 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 IFVGNLTDKTRAPEVRELFQKYGTVVECDI-----VRNYGFVHLDCVGDVQDAIKELNGRVVDGQ 147
            |:||||....|..||.:||.|||.:|:.|:     ...|.||..:...|..|||...:|...||.
plant     9 IYVGNLPGDIRKCEVEDLFYKYGPIVDIDLKIPPRPPGYAFVEFEDPRDADDAIYGRDGYDFDGC 73

  Fly   148 PLKVQVSTSRVRPKPGMGDPEQCYRCGRSGHWSKECPRLYGSAGGGREPPSPLSAGGYRDRMYGR 212
            .|:|:::....|..|.:......|...|                      :|.....||..:.|.
plant    74 RLRVEIAHGGRRFSPSVDRYSSSYSASR----------------------APSRRSDYRVLVTGL 116

  Fly   213 DPYPPPPPPPPFLRDRI-----------------MDGFRDYDYYD------RRFE--DSRDLYER 252
                ||......|:|.:                 |.|..||..||      |:.:  :.|:.:..
plant   117 ----PPSASWQDLKDHMRKAGDVCFSEVFPDRKGMSGVVDYSNYDDMKYAIRKLDATEFRNAFSS 177

  Fly   253 RYQTSRMRDFPPPPISRREPMPLPPTLSGSLRSCSVSRGYDTMFS--RRSPPPPRSSNGMSRYGS 315
            .|  .|:|::....:||      .|..|.|.||.|.|||....:|  .||..|.||.:..||..|
plant   178 AY--IRVREYESRSVSR------SPDDSKSYRSRSRSRGPSCSYSSKSRSVSPARSISPRSRPLS 234

  Fly   316 PTPHGYEDFSRDAFDERMISSRGMRGPSP 344
            .:...|...||.  ..|..|....|..||
plant   235 RSRSLYSSVSRS--QSRSKSRSRSRSNSP 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 26/68 (38%)
hnRNP-R-Q <88..>258 CDD:273732 48/199 (24%)
SR30NP_172386.3 RRM <1..165 CDD:223796 45/181 (25%)
RRM1_SF2_plant_like 8..79 CDD:241043 27/69 (39%)
RRM2_SF2_plant_like 109..184 CDD:241046 17/80 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.