DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and CP31B

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_199836.1 Gene:CP31B / 835090 AraportID:AT5G50250 Length:289 Species:Arabidopsis thaliana


Alignment Length:175 Identity:54/175 - (30%)
Similarity:85/175 - (48%) Gaps:23/175 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLFIGNLDEKTQATELRALFEKYGTVVECDVVKN--------YGFVHMETEQQGRDAIQNLNGYT 64
            |||:|||.....:..|..|||:.|||...:|:.|        :|||.|.|.::...|::..|.:.
plant   114 KLFVGNLPYDVDSQALAMLFEQAGTVEISEVIYNRDTDQSRGFGFVTMSTVEEAEKAVEKFNSFE 178

  Fly    65 LNEFAIKVEAAKSR-----RAPNT--PTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDIV---- 118
            :|...:.|..|..|     |.|..  ...:|:||||.....:..:..||.::|.||:..:|    
plant   179 VNGRRLTVNRAAPRGSRPERQPRVYDAAFRIYVGNLPWDVDSGRLERLFSEHGKVVDARVVSDRE 243

  Fly   119 ----RNYGFVHLDCVGDVQDAIKELNGRVVDGQPLKVQVSTSRVR 159
                |.:|||.:....:|..||..|:|:.::|:.:||.|:..|.|
plant   244 TGRSRGFGFVQMSNENEVNVAIAALDGQNLEGRAIKVNVAEERTR 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 23/72 (32%)
RRM1_2_CoAA_like 87..152 CDD:409779 22/72 (31%)
hnRNP-R-Q <88..>258 CDD:273732 26/80 (33%)
CP31BNP_199836.1 RRM_SF 114..193 CDD:418427 25/78 (32%)
RRM2_NsCP33_like 208..283 CDD:410187 23/74 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.