DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and RSZ22

DIOPT Version :10

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_194886.1 Gene:RSZ22 / 829285 AraportID:AT4G31580 Length:200 Species:Arabidopsis thaliana


Alignment Length:249 Identity:65/249 - (26%)
Similarity:96/249 - (38%) Gaps:86/249 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 TKIFVGNLTDKTRAPEVRELFQKYGTVVECDIVR---NYGFVHLDCVGDVQDAIKELNGRVVDGQ 147
            ::::||||..:....|:.:.|:.:|.|....:.|   .|.|:..:...|.:|||:.|:|:    .
plant     2 SRVYVGNLDPRVTERELEDEFRAFGVVRSVWVARRPPGYAFLDFEDPRDARDAIRALDGK----N 62

  Fly   148 PLKVQVSTSRVR---------------PKPGMGDPE-QCYRCGRSGHWSKECPRLYGSAGGGREP 196
            ..:|:.|.:|..               .:.|.|..: :||.||.:||:::|| |..|..|     
plant    63 GWRVEQSHNRGERGGGGRGGDRGGGGGGRGGRGGSDLKCYECGETGHFAREC-RNRGGTG----- 121

  Fly   197 PSPLSAGGYRDRMYGRDPYPPPPPPPPFLRDRIMDGFRDYDYYDRRFEDSRDLYERRYQTSRMRD 261
                     |.|...|...||                        |:..|.. |.||..:.|.|.
plant   122 ---------RRRSKSRSRTPP------------------------RYRRSPS-YGRRSYSPRARS 152

  Fly   262 FPPPPISRREPMPLPPTLSGSLRSCSVSRGYDTMFSRRSPPPPRS------SNG 309
             |||| .||.|.| ||         :..|.|.     |||||.|:      :||
plant   153 -PPPP-RRRSPSP-PP---------ARGRSYS-----RSPPPYRAREEVPYANG 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 17/67 (25%)
hnRNP-R-Q <88..>258 CDD:273732 43/188 (23%)
RSZ22NP_194886.1 RRM_SRSF3_like 3..71 CDD:409808 19/71 (27%)
zf-CCHC 100..114 CDD:395050 6/13 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.