DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and RSZ22

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001078474.1 Gene:RSZ22 / 829285 AraportID:AT4G31580 Length:200 Species:Arabidopsis thaliana


Alignment Length:249 Identity:65/249 - (26%)
Similarity:96/249 - (38%) Gaps:86/249 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 TKIFVGNLTDKTRAPEVRELFQKYGTVVECDIVR---NYGFVHLDCVGDVQDAIKELNGRVVDGQ 147
            ::::||||..:....|:.:.|:.:|.|....:.|   .|.|:..:...|.:|||:.|:|:    .
plant     2 SRVYVGNLDPRVTERELEDEFRAFGVVRSVWVARRPPGYAFLDFEDPRDARDAIRALDGK----N 62

  Fly   148 PLKVQVSTSRVR---------------PKPGMGDPE-QCYRCGRSGHWSKECPRLYGSAGGGREP 196
            ..:|:.|.:|..               .:.|.|..: :||.||.:||:::|| |..|..|     
plant    63 GWRVEQSHNRGERGGGGRGGDRGGGGGGRGGRGGSDLKCYECGETGHFAREC-RNRGGTG----- 121

  Fly   197 PSPLSAGGYRDRMYGRDPYPPPPPPPPFLRDRIMDGFRDYDYYDRRFEDSRDLYERRYQTSRMRD 261
                     |.|...|...||                        |:..|.. |.||..:.|.|.
plant   122 ---------RRRSKSRSRTPP------------------------RYRRSPS-YGRRSYSPRARS 152

  Fly   262 FPPPPISRREPMPLPPTLSGSLRSCSVSRGYDTMFSRRSPPPPRS------SNG 309
             |||| .||.|.| ||         :..|.|.     |||||.|:      :||
plant   153 -PPPP-RRRSPSP-PP---------ARGRSYS-----RSPPPYRAREEVPYANG 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 17/67 (25%)
hnRNP-R-Q <88..>258 CDD:273732 43/188 (23%)
RSZ22NP_001078474.1 RRM_SRSF3_like 3..71 CDD:409808 19/71 (27%)
zf-CCHC 100..114 CDD:395050 6/13 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.