DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and RS40

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001190837.1 Gene:RS40 / 828654 AraportID:AT4G25500 Length:350 Species:Arabidopsis thaliana


Alignment Length:364 Identity:96/364 - (26%)
Similarity:145/364 - (39%) Gaps:67/364 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFIGNLDEKTQATELRALFEKYGTVVECDVVKNYGFVHMETEQQGRDAIQNLNGYTLNEFA---- 69
            :|.||.:...:..:|..||.|||.|...|:...:.||:||.|:...|||:.|:.:   ||.    
plant     4 VFCGNFEYDAREGDLERLFRKYGKVERVDMKAGFAFVYMEDERDAEDAIRALDRF---EFGRKGR 65

  Fly    70 -IKVEAAKSRRAPN--------------TPTTKIFVGNL-TDKTRAPEVRELFQKYGTVVECDIV 118
             ::||..||.|..:              .|:..:||.|. .|.||..::.:.|:.||.:|...|.
plant    66 RLRVEWTK
SERGGDKRSGGGSRRSSSSMRPSKTLFVINFDADNTRTRDLEKHFEPYGKIVNVRIR 130

  Fly   119 RNYGFVHLDCVGDVQDAIKELNGRVVDGQPLKVQVSTSRVRPKPGMGDPEQCYRCGRSGHWSKEC 183
            ||:.|:..:...|...|:...|...:..:.:.|:.:......:.....||:  |..||....:..
plant   131 RNFAFIQYEAQEDATRALDASNNSKLMDKVISVEYAVKDDDARGNGHSPER--RRDRSPERRRRS 193

  Fly   184 PRLY----GSAGGGREPPSPLSAGGYRDRMYGRDPYPPPPPPPPFLRDRIMDGFRDYDYYDRRFE 244
            |..|    ||...|| ..||::|  ||......| |.....|.|:.:.|  .|..:|. .|||..
plant   194 PSPYKRERGSPDYGR-GASPVAA--YRKERTSPD-YGRRRSPSPYKKSR--RGSPEYG-RDRRGN 251

  Fly   245 DSRDLYERRYQTSRMRDFPPPPISRREPMPLPPTLSGSLRSCSVSRGYDTMFSRRSPPPPRSSNG 309
            ||.   .||.:.:....:...|.::||.|  .|..|              .|.:.||     .||
plant   252 DSP---RRRERVASPTKYSRSPNNKRERM--SPNHS--------------PFKKESP-----RNG 292

  Fly   310 MSRYGSPTPHGYEDFSRDAFDERMISSRGMRGPSPPGRR 348
            :....||...  .:.||.:.:...:.|     |...|||
plant   293 VGEVESPIER--RERSRSSPENGQVES-----PGSIGRR 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 22/68 (32%)
RRM1_2_CoAA_like 87..152 CDD:409779 17/65 (26%)
hnRNP-R-Q <88..>258 CDD:273732 48/174 (28%)
RS40NP_001190837.1 RRM1_AtRSp31_like 2..73 CDD:240680 24/71 (34%)
RRM_SF 98..167 CDD:388407 18/68 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1563362at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104638
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.