DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and AT4G12640

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_193001.2 Gene:AT4G12640 / 826877 AraportID:AT4G12640 Length:823 Species:Arabidopsis thaliana


Alignment Length:417 Identity:85/417 - (20%)
Similarity:147/417 - (35%) Gaps:132/417 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFIGNLDEKTQATELRALFEKYGTV--VECDVVKNYGFVHMETEQQGRDAIQNLNGYTLNEFAIK 71
            |::|||.......||...|.::|.:  :.....::|.||:...::....||::|.|:.|:...::
plant    25 LWVGNLPHGILERELADRFLRFGELESLAFQPGRSYAFVNFNHDEDAFAAIESLQGFPLSGNPLR 89

  Fly    72 VEAAKSRR-----------------------------------APNT------------PTTKIF 89
            :|.||:.:                                   :|:|            |:..::
plant    90 IEFAKAEKSSTGSRTDDIYRHDEQRSAARGSSFVQRDSRMRYESPDTYSKSKMNDRNAEPSEVLY 154

  Fly    90 VG-NLTDKTRAPEVRELFQKYGTVVECDIV--RNYGFVHLDCVGDVQDAIKELNGRVVDGQPLKV 151
            :| ..:.|.....:|.:|..:|.:.:..:.  |:|.||....:.....|.:.|.|::. |.| :|
plant   155 IGFPASLKVDDALLRNVFSSFGEITKVTVFPGRSYAFVQFRNLMAACKAKESLQGKLF-GNP-RV 217

  Fly   152 QVSTSRVRPKPGMGDPEQCYRCGRSGHWSKECPRLYGSAGGGREPP----SPL--------SAGG 204
            .:..::..|                           .|:|.||.|.    ||.        |:.|
plant   218 HICFAKSEP---------------------------SSSGSGRGPSGRSLSPPYRSVDRLGSSEG 255

  Fly   205 Y-RDRMYGRDPYPPPPPPPPFLRDRIMDGFRDYDYYDRRFEDSRD---LYERRYQTSR------- 258
            | :||.||.....|....|.::.||.::....| .::|:.:.|.|   .|.|...|.|       
plant   256 YLQDRNYGSISRIPSVREPHYIEDRDLEDSEGY-IFNRKRDSSSDGGPAYGRSRSTHRFPQDMHE 319

  Fly   259 -----------MRDFPPPPISR----REPMPLPPTLSGSLRSCSVSRGYDTMFSRRSPP----PP 304
                       .||.|....:|    .||..||   ........:.|    :.:|.|.|    |.
plant   320 YHGSPGEMGTSFRDNPHRFQTRSSEYEEPWDLP---EDDYYYQEIKR----LKTRSSQPERQLPG 377

  Fly   305 RSSNGMSRYGSPTPHGYEDFS-RDAFD 330
            ...:|:.:...|......||| :|||:
plant   378 HQLSGIEQERRPFSRASADFSPKDAFE 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 16/65 (25%)
RRM1_2_CoAA_like 87..152 CDD:409779 14/67 (21%)
hnRNP-R-Q <88..>258 CDD:273732 41/188 (22%)
AT4G12640NP_193001.2 RRM3_Spen 25..94 CDD:240756 17/68 (25%)
RRM_SF 153..223 CDD:302621 15/71 (21%)
SPOC 471..567 CDD:285043
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.