DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and RS2Z32

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_190918.3 Gene:RS2Z32 / 824518 AraportID:AT3G53500 Length:284 Species:Arabidopsis thaliana


Alignment Length:309 Identity:85/309 - (27%)
Similarity:115/309 - (37%) Gaps:87/309 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 TKIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRNYGFVHLDCVGDVQDAIKELNGRVVDGQPLK 150
            |:::||.|:.:||..::..||.:||.|.:.|:.|:|.||......|..||...|:||..||..:.
plant    11 TRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFSDPRDADDARYYLDGRDFDGSRIT 75

  Fly   151 VQVSTSRVR---------PKPGMGDPEQCYRCGRSGHWSKECP------RLYGSAGGG------R 194
            |:.|....|         |.||.|   :|:.||..|||:::|.      :.|.....|      :
plant    76 VEASRGAPRGSRDNGSRGPPPGSG---RCFNCGVDGHWARDCTAGDWKNKCYRCGERGHIERNCK 137

  Fly   195 EPPSPLSA--GGYRDRMYGRDPYPPPPPPPPFLRDRIMDGFRDYDYYDRRFEDSRD-LYERRYQT 256
            ..|||..|  ||    .|.|.|.....|                   .||...||. .|.|....
plant   138 NSPSPKKARQGG----SYSRSPVKSRSP-------------------RRRRSPSRSRSYSRGRSY 179

  Fly   257 SRMRDFPPPPISR--------REPMPLPPTLSGSLRSCSVS-----------RGYDTMFSRRSPP 302
            ||.|.    |:.|        |.|..:..::|...|..|:|           ||.|...|     
plant   180 SRSRS----PVRREKSVEDRSRSPKAMERSVSPKGRDQSLSPDRKVIDASPKRGSDYDGS----- 235

  Fly   303 PPRSSNGMSRY-----GSPTPHGYEDFSRDAFDERMISSRGMRGPSPPG 346
            |..:.||.:..     |..:|.|.....|...|:....||    |||.|
plant   236 PKENGNGRNSASPIVGGGESPVGLNGQDRSPIDDEAELSR----PSPKG 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 23/64 (36%)
hnRNP-R-Q <88..>258 CDD:273732 55/193 (28%)
RS2Z32NP_190918.3 RRM_SF 12..81 CDD:388407 25/68 (37%)
PTZ00368 <86..142 CDD:173561 14/58 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.