DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and SR34a

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001190041.1 Gene:SR34a / 824105 AraportID:AT3G49430 Length:300 Species:Arabidopsis thaliana


Alignment Length:316 Identity:80/316 - (25%)
Similarity:112/316 - (35%) Gaps:105/316 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 IFVGNLTDKTRAPEVRELFQKYGTVVECDI-----VRNYGFVHLDCVGDVQDAIKELNGRVVDGQ 147
            |:||||....|..|:.::|.|||.:|:.::     ...|.||..:...|.:||||..:|..:||.
plant     9 IYVGNLPGDIREHEIEDIFYKYGRIVDIELKVPPRPPCYCFVEFEHSRDAEDAIKGRDGYNLDGC 73

  Fly   148 PLKVQVSTSRVRPKPGMGDPEQCYRCGRSGHWSKECPRLYGSAGGG------------------R 194
            .|:|:::..      |.|......|.|..|..|.     ||..|||                  |
plant    74 RLRVELAHG------GRGQSSSDRRGGYGGGGSG-----YGGGGGGGGSARFGVSRHSEFRVIVR 127

  Fly   195 EPPSPLSAGGYRDRM------------------YGRDPYPPPPPPPPFLRDRIMDGFRDYDYYDR 241
            ..||..|....:|.|                  ||...|               ..:.|..|..|
plant   128 GLPSSASWQDLKDHMRKAGDVCFAEVTRDSDGTYGVVDY---------------TNYDDMKYAIR 177

  Fly   242 RFEDS--RDLYER------RYQTSRMRDFPPPPISRREPMPLPPTLSGSLRSCSVSRGYDTMFSR 298
            :.:|:  |:.:.|      :|::||.|...|.....|.            ||.|.|||.....||
plant   178 KLDDTEFRNPWARGFIRVKKYESSRSRSRSPSRSRSRS------------RSRSRSRGRGRSHSR 230

  Fly   299 RSPPPPRSSNGMSRYGSPTPHGYEDFSRDAFDERMISSRGM---RGPSPPGRRYAP 351
                    |..:||..||.    :|.|:   ..|...||.:   |.|||..::..|
plant   231 --------SRSLSRSKSPR----KDLSK---SPRRSLSRSISKSRSPSPDKKKSPP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 24/68 (35%)
hnRNP-R-Q <88..>258 CDD:273732 52/218 (24%)
SR34aNP_001190041.1 RRM_SF 9..79 CDD:418427 25/69 (36%)
RRM2_SF2_plant_like 122..197 CDD:410014 15/89 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.