DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and NUC-L2

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_188491.1 Gene:NUC-L2 / 821392 AraportID:AT3G18610 Length:636 Species:Arabidopsis thaliana


Alignment Length:253 Identity:57/253 - (22%)
Similarity:97/253 - (38%) Gaps:55/253 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GTFKLFIGNLDEKTQATELRALFEKYGTVVECDV-------VKNYGFVHMETEQQGRDAIQNLNG 62
            |:..||.|||..:...:::...|::.|.||:..:       .|.||.:...:.::.:.|:: :||
plant   382 GSKTLFAGNLSYQIARSDIENFFKEAGEVVDVRLSSFDDGSFKGYGHIEFASPEEAQKALE-MNG 445

  Fly    63 YTLNEFAIKVEAAKSRRAP--------------NTPTTKIFVGNLTDKTRAPEVRELFQKYGTVV 113
            ..|....::::.|..|..|              .|...:.|..:|.:.....|:|..|.|.|.|.
plant   446 KLLLGRDVRLDLANERGTPRNSNPGRKGEGSQSRTIYVRGFSSSLGEDEIKKELRSHFSKCGEVT 510

  Fly   114 ECDIV------RNYGFVHLDCVGDVQDAIKELNGRVVDGQPLKVQVSTSRVRPK----------- 161
            ...:.      .:.||.::|......:|: :|:|..:.|..:.|:.|    ||:           
plant   511 RVHVPTDRETGASRGFAYIDLTSGFDEAL-QLSGSEIGGGNIHVEES----RPRDSDEGRSSNRA 570

  Fly   162 PGMGDPEQCY--RCGRSGHWSKECPRLYGSAGGGREPPSPLSAGGYRDRMYGRDPYPP 217
            |..|.|...:  |..|.|.:|...||       ||........|.:..|  ||.|..|
plant   571 PARGAPRGRHSDRAPRGGRFSDRAPR-------GRHSDRGAPRGRFSTR--GRGPSKP 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 16/71 (23%)
RRM1_2_CoAA_like 87..152 CDD:409779 15/70 (21%)
hnRNP-R-Q <88..>258 CDD:273732 36/149 (24%)
NUC-L2NP_188491.1 RRM1_NUCLs 385..461 CDD:409884 17/76 (22%)
RRM2_NUCLs 480..556 CDD:409885 17/76 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.