DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and RS31a

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_182184.1 Gene:RS31a / 819273 AraportID:AT2G46610 Length:250 Species:Arabidopsis thaliana


Alignment Length:320 Identity:80/320 - (25%)
Similarity:118/320 - (36%) Gaps:92/320 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFIGNLDEKTQATELRALFEKYGTVVECDVVKNYGFVHMETEQQGRDAIQNLNGYTL--NEFAIK 71
            :::||.|..|:.::|..||.|:|.|...|:...|.||:.|.|:...|||:..:..|.  ....:.
plant     4 VYVGNFDYDTRHSDLERLFSKFGRVKRVDMKSGYAFVYFEDERDAEDAIRRTDNTTFGYGRRKLS 68

  Fly    72 VEAAK----SRRAP--------NTPTTKIFVGNLTD-KTRAPEVRELFQKYGTVVECDIVRNYGF 123
            ||.||    .|..|        ..||..:||.|... :||..::...|:.||.|:...:.||:.|
plant    69 VEWAK
DFQGERGKPRDGKAVSNQRPTKTLFVINFDPIRTRERDMERHFEPYGKVLNVRMRRNFAF 133

  Fly   124 VHLDCVGDVQDAIKEL----NGRVVDGQPLKVQVSTSRVRPKPGMGDPEQCYRCGRSGHWSKECP 184
            |..   ...:||.|.|    |.:::| :.:.|:.:....      |:.|..|...|.        
plant   134 VQF---ATQEDATKALDSTHNSKLLD-KVVSVEYALREA------GEREDRYAGSRR-------- 180

  Fly   185 RLYGSAGGGREPPSPLSAGGYRDRMYGRDPYPPPPPPPPFLRDRIMDGFRDYDYYDRRFEDSRDL 249
                     |..|||:    ||.|           |.|.:.|.|    ..:||.|.         
plant   181 ---------RRSPSPV----YRRR-----------PSPDYTRRR----SPEYDRYK--------- 208

  Fly   250 YERRYQTSRMRDFPPPPISRREPMPLPPTLSGSLRSCSVSRGYDTMFSRRSPPPPRSSNG 309
                         .|.|..||:........|...|:.:.|.|||     ||..|.:.:.|
plant   209 -------------GPAPYERRKSPDYGRRSSDYGRARARSPGYD-----RSRSPIQRARG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 20/65 (31%)
RRM1_2_CoAA_like 87..152 CDD:409779 19/69 (28%)
hnRNP-R-Q <88..>258 CDD:273732 38/174 (22%)
RS31aNP_182184.1 RRM_SF 2..73 CDD:302621 22/68 (32%)
RRM_SF 96..165 CDD:302621 20/72 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1563362at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104638
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.