DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and RS2Z33

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_850280.1 Gene:RS2Z33 / 818311 AraportID:AT2G37340 Length:290 Species:Arabidopsis thaliana


Alignment Length:312 Identity:80/312 - (25%)
Similarity:110/312 - (35%) Gaps:87/312 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 TKIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRNYGFVHLDCVGDVQDAIKELNGRVVDGQPLK 150
            |:::||.|:.:||..::..||.:||.|.:.|:.|:|.||......|..||...|:||..||..:.
plant    11 TRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFGDPRDADDARHYLDGRDFDGSRIT 75

  Fly   151 VQVSTSRVR---------PKPGMGDPEQCYRCGRSGHWSKECP------RLYGSAGGG------R 194
            |:.|....|         |.||.|   :|:.||..|||:::|.      :.|.....|      :
plant    76 VEFSRGAPRGSRDFDSRGPPPGAG---RCFNCGVDGHWARDCTAGDWKNKCYRCGERGHIERNCK 137

  Fly   195 EPPSPLSAGGYRDRMYGRDPYPPPPPPPPFLRDRIMDGFRDYDYYDRRFEDSRDL-YERRYQTSR 258
            ..|..|...|    .|.|.|.....|                   .||...||.| ..|.|..||
plant   138 NSPKKLRRSG----SYSRSPVRSRSP-------------------RRRRSPSRSLSRSRSYSRSR 179

  Fly   259 MRDFPPPPISRRE---------PMPLPPTLSGSLRSCSV---SRGYDTMFSRRSPPPPR------ 305
                  .|:.|||         |..:..:||...|..|.   ..|...:.....||.|:      
plant   180 ------SPVRRRERSVEERSRSPKRMDDSLSPRARDRSPVLDDEGSPKIIDGSPPPSPKLQKEVG 238

  Fly   306 --------SSNGMSRYGSPTPHGYEDFSR-------DAFDERMISSRGMRGP 342
                    ..||.:...||......|.|:       |.::....|.||...|
plant   239 SDRDGGSPQDNGRNSVVSPVVGAGGDSSKEDRSPVDDDYEPNRTSPRGSESP 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 23/64 (36%)
hnRNP-R-Q <88..>258 CDD:273732 53/191 (28%)
RS2Z33NP_850280.1 RRM_SF 12..81 CDD:418427 25/68 (37%)
PTZ00368 <86..144 CDD:173561 14/60 (23%)
MSCRAMM_ClfB <209..>289 CDD:411414 15/79 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.