DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and Srsf1

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001103022.1 Gene:Srsf1 / 689890 RGDID:1587490 Length:248 Species:Rattus norvegicus


Alignment Length:270 Identity:67/270 - (24%)
Similarity:95/270 - (35%) Gaps:83/270 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRNYG-----FVHLDCVGDVQDAIKELNGRVVDG 146
            :|:||||....|..::.::|.|||.:.:.|:....|     ||..:...|.:||:...:|...||
  Rat    17 RIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDG 81

  Fly   147 QPLKVQVSTSRVRPKPGMGDPEQCYRCGRSGHWSKECPRLYGSAGGGREPPSPLSAGGYRDRMYG 211
            ..|:|:.      |:.|.|       .||.|          |..|||..|               
  Rat    82 YRLRVEF------PRSGRG-------TGRGG----------GGGGGGGAP--------------- 108

  Fly   212 RDPYPPP-------------PPPPPF--LRDRI--------MDGFR------------DYDYYDR 241
            |..|.||             ||...:  |:|.:        .|.:|            |..|..|
  Rat   109 RGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVR 173

  Fly   242 RFEDSRDLYERRYQTSRMR---DFPPPPISRREPMPLPPTLSGSLRSCSVSRGYDTMFSRRSPP- 302
            :.:::: ......:|:.:|   |.|..|...|.............||.|.||.|....||.||. 
  Rat   174 KLDNTK-FRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRY 237

  Fly   303 PPRSSNGMSR 312
            .||.|...||
  Rat   238 SPRHSRSRSR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 21/69 (30%)
hnRNP-R-Q <88..>258 CDD:273732 47/209 (22%)
Srsf1NP_001103022.1 RRM1_SRSF1 12..90 CDD:410010 22/78 (28%)
RRM2_SRSF1 113..196 CDD:410160 13/83 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.