Sequence 1: | NP_523957.1 | Gene: | lark / 38811 | FlyBaseID: | FBgn0011640 | Length: | 352 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001103022.1 | Gene: | Srsf1 / 689890 | RGDID: | 1587490 | Length: | 248 | Species: | Rattus norvegicus |
Alignment Length: | 270 | Identity: | 67/270 - (24%) |
---|---|---|---|
Similarity: | 95/270 - (35%) | Gaps: | 83/270 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 87 KIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRNYG-----FVHLDCVGDVQDAIKELNGRVVDG 146
Fly 147 QPLKVQVSTSRVRPKPGMGDPEQCYRCGRSGHWSKECPRLYGSAGGGREPPSPLSAGGYRDRMYG 211
Fly 212 RDPYPPP-------------PPPPPF--LRDRI--------MDGFR------------DYDYYDR 241
Fly 242 RFEDSRDLYERRYQTSRMR---DFPPPPISRREPMPLPPTLSGSLRSCSVSRGYDTMFSRRSPP- 302
Fly 303 PPRSSNGMSR 312 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lark | NP_523957.1 | RRM1_2_CoAA_like | 8..73 | CDD:409779 | |
RRM1_2_CoAA_like | 87..152 | CDD:409779 | 21/69 (30%) | ||
hnRNP-R-Q | <88..>258 | CDD:273732 | 47/209 (22%) | ||
Srsf1 | NP_001103022.1 | RRM1_SRSF1 | 12..90 | CDD:410010 | 22/78 (28%) |
RRM2_SRSF1 | 113..196 | CDD:410160 | 13/83 (16%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |