DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and Rbm24

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001074894.1 Gene:Rbm24 / 666794 MGIID:3610364 Length:236 Species:Mus musculus


Alignment Length:93 Identity:27/93 - (29%)
Similarity:45/93 - (48%) Gaps:12/93 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 NTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDIV--------RNYGFVHLDCVGDVQDAIKE 138
            :|..||||||.|...|....:|:.|:.:|.:.|..::        |.||||.:......:.|.|:
Mouse     7 DTTYTKIFVGGLPYHTTDASLRKYFEVFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKD 71

  Fly   139 LNGRVVDGQPLKVQVSTSRVRPK---PG 163
            .| .::||:...|.::....:|:   ||
Mouse    72 PN-PIIDGRKANVNLAYLGAKPRIMQPG 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 21/72 (29%)
hnRNP-R-Q <88..>258 CDD:273732 24/87 (28%)
Rbm24NP_001074894.1 RRM_RBM24_RBM38_like 11..86 CDD:409818 23/75 (31%)
Necessary for interaction with EIF4E. /evidence=ECO:0000250|UniProtKB:Q9BX46 175..199
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.