DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and TRA2B

DIOPT Version :10

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_004584.1 Gene:TRA2B / 6434 HGNCID:10781 Length:288 Species:Homo sapiens


Alignment Length:261 Identity:63/261 - (24%)
Similarity:89/261 - (34%) Gaps:101/261 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 RAPNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDIV--------RNYGFVHLDCVGDVQDA 135
            ||...|...:.|..|:..|...::||:|.|||.:.:..||        |.:.||:.:.|.|.::|
Human   111 RANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEA 175

  Fly   136 IKELNGRVVDGQPLKVQVS-TSRVR-PKPG--MGDPEQCYRCGRSGHWSKECPRLYGSAGGGREP 196
            .:..||..:||:.::|..| |.|.. |.||  ||.|                  .|||:      
Human   176 KERANGMELDGRRIRVDFSITKRPHTPTPGIYMGRP------------------TYGSS------ 216

  Fly   197 PSPLSAGGYRDRMYGRDPYPPPPPPPPFLRDRIMDGFRDYDYYDRRFE---DSRDLYERRYQTSR 258
                                                 |..|||||.::   |.||.|.|.|:.. 
Human   217 -------------------------------------RRRDYYDRGYDRGYDDRDYYSRSYRGG- 243

  Fly   259 MRDFPPPPISRREPMPLPPTLSGSLRSCSVSRGYDTMFSRRSPPPPRSSNG---MSRYGSPTPHG 320
                                 .|.......::..|.::.||||.|..|..|   .||..|.:|..
Human   244 ---------------------GGGGGGWRAAQDRDQIYRRRSPSPYYSRGGYRSRSRSRSYSPRR 287

  Fly   321 Y 321
            |
Human   288 Y 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 21/72 (29%)
hnRNP-R-Q <88..>258 CDD:273732 46/184 (25%)
TRA2BNP_004584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..114 2/2 (100%)
RRM_TRA2 117..196 CDD:409798 23/78 (29%)
Linker 193..230 18/97 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..225 16/89 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..288 13/67 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.