DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and elavl3

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_012808614.1 Gene:elavl3 / 594912 XenbaseID:XB-GENE-490864 Length:363 Species:Xenopus tropicalis


Alignment Length:167 Identity:44/167 - (26%)
Similarity:74/167 - (44%) Gaps:20/167 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFIGNLDEKTQATELRALFEKYGTVVECDVVKN--------YGFVHMETEQQGRDAIQNLNGYTL 65
            |.:..|.:.....|.::||...|.:..|.:|::        ||||:.........||..|||..|
 Frog    37 LIVNYLPQNMTQEEFKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYVDPNDADKAINTLNGLKL 101

  Fly    66 NEFAIKVEAAKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDIV---------RNY 121
            ....|||..|:...| :.....::|.:|.......|:.:||.:||.::...|:         |..
 Frog   102 QTKTIKVSYARPSSA-SIRDANLYVSSLPKTMNQKEMEQLFSQYGRIITSRILVDQVTGSVSRGV 165

  Fly   122 GFVHLDCVGDVQDAIKELNGRVVDG--QPLKVQVSTS 156
            ||:..|...:.::|||.|||:...|  :|:.|:.:.:
 Frog   166 GFIRFDKRIEAEEAIKGLNGQKPLGASEPITVKFANN 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 20/71 (28%)
RRM1_2_CoAA_like 87..152 CDD:409779 20/75 (27%)
hnRNP-R-Q <88..>258 CDD:273732 21/80 (26%)
elavl3XP_012808614.1 ELAV_HUD_SF 32..362 CDD:273741 44/167 (26%)
RRM1_Hu 34..111 CDD:241094 21/73 (29%)
RRM_SF 116..206 CDD:302621 22/88 (25%)
RRM3_HuC 279..363 CDD:241099
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.