DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and PABPC3

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_112241.2 Gene:PABPC3 / 5042 HGNCID:8556 Length:631 Species:Homo sapiens


Alignment Length:180 Identity:49/180 - (27%)
Similarity:83/180 - (46%) Gaps:28/180 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AGTFKLFIGNLDEKTQATELRALFEKYGTVVECDVV------KNYGFVHMETEQQGRDAIQNLNG 62
            :|...:|:.|||:......|......:|.::.|:||      |.|||||.||.:....||:.:||
Human    96 SGVGNIFVKNLDKSINNKALYDTVSAFGNILSCNVVCDENGSKGYGFVHFETHEAAERAIKKMNG 160

  Fly    63 YTLNEFAIKVEAAKSR---------RAPNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDIV 118
            ..||...:.|...|||         ||...|  .:::.|..:......:::||.|:|..:...::
Human   161 MLLNGRKVFVGQFKSRKEREAELGARAKEFP--NVYIKNFGEDMDDERLKDLFGKFGPALSVKVM 223

  Fly   119 -------RNYGFVHLDCVGDVQDAIKELNGRVVDGQPLKVQVSTSRVRPK 161
                   :.:|||..:...|.|.|:.|:||:.::|:    |:...|.:.|
Human   224 TDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGK----QIYVGRAQKK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 23/70 (33%)
RRM1_2_CoAA_like 87..152 CDD:409779 15/71 (21%)
hnRNP-R-Q <88..>258 CDD:273732 18/81 (22%)
PABPC3NP_112241.2 PABP-1234 11..610 CDD:130689 49/180 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.