DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and Rbm4b

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001007015.2 Gene:Rbm4b / 474154 RGDID:1359343 Length:357 Species:Rattus norvegicus


Alignment Length:347 Identity:115/347 - (33%)
Similarity:166/347 - (47%) Gaps:75/347 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLFIGNLDEKTQATELRALFEKYGTVVECDVVKNYGFVHMETEQQGRDAIQNLNGYTLNEFAIKV 72
            |||||||..:....|:|:|||:||.|:|||::|||||||:|.:....|||:||:.|.|:...|.|
  Rat     3 KLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINV 67

  Fly    73 EAAKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRNYGFVHLDCVGDVQDAIK 137
            ||:|::   :..:||:.|||::......|:|..|::||.|:|||||::|.|||::...|..:||:
  Rat    68 EASKNK---SKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIR 129

  Fly   138 ELNGRVVDGQPLKVQVSTSRVRPKPGMGDPEQCYRCGRSGHWSKECP-----------RLYGSAG 191
            .|:.....|:.:.||:||||:|..|||||...|||||:.||||||||           ..|....
  Rat   130 GLDNTEFQGKRMHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPVDRTGRVADFTEQYNEQY 194

  Fly   192 GGREPPSPLSAGGYRDRMYGRDPYPPPPPPPPFLRDRIMDGFRDYDYYDRRFEDSRDLYERRYQT 256
            |....|..:   ||.:.||..|.|..                  .|||            :||  
  Rat   195 GAVRTPYTM---GYGESMYYNDAYGA------------------LDYY------------KRY-- 224

  Fly   257 SRMRDFPPPPISRREPMPLPPTLSGSLRSCSVSRGYDTMFSRRSPPPPRSSNGMSRYGSPTPHGY 321
             |:|.:.                  ::.:.:.:..|:......|..|...|       |..|...
  Rat   225 -RVRSYE------------------AVAAAAAASAYNYAEQTMSHLPQVQS-------SAVPSHL 263

  Fly   322 EDFSRDAFDERMISSRGMRGPS 343
            ...|.|.:|..::.:.|....|
  Rat   264 NSTSVDPYDRHLLQNSGSAATS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 34/64 (53%)
RRM1_2_CoAA_like 87..152 CDD:409779 24/64 (38%)
hnRNP-R-Q <88..>258 CDD:273732 62/180 (34%)
Rbm4bNP_001007015.2 RRM1_RBM4 2..68 CDD:241050 34/64 (53%)
RRM2_RBM4 78..144 CDD:241051 25/65 (38%)
ZnF_C2HC 161..176 CDD:197667 11/14 (79%)
Interaction with TNPO3. /evidence=ECO:0000250 196..357 25/151 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I8934
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3794
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1563362at2759
OrthoFinder 1 1.000 - - FOG0002310
OrthoInspector 1 1.000 - - oto95741
orthoMCL 1 0.900 - - OOG6_104638
Panther 1 1.100 - - LDO PTHR23147
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1736
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.