DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and spen

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_722615.1 Gene:spen / 44205 FlyBaseID:FBgn0016977 Length:5560 Species:Drosophila melanogaster


Alignment Length:156 Identity:44/156 - (28%)
Similarity:76/156 - (48%) Gaps:11/156 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TFKLFIGNLDEKTQATELRALFEKYGTVVECDVVKN----YGFVHMETEQQGRDAIQNLNGYTLN 66
            |..||||||::...|.|||:.||.:|.::|.|:.|.    |.|...........|::.::|..|.
  Fly   655 TRTLFIGNLEKDITAGELRSHFEAFGEIIEIDIKKQGLNAYAFCQYSDIVSVVKAMRKMDGEHLG 719

  Fly    67 EFAIKVEAAKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRN--YGFVHLDCV 129
            ...||:...||     .||..:::..:.:|.....::..|.::|.|.:..|.||  ...|..|.|
  Fly   720 SNRIKLGFGKS-----MPTNCVWIDGVDEKVSESFLQSQFTRFGAVTKVSIDRNRQLALVLYDQV 779

  Fly   130 GDVQDAIKELNGRVVDGQPLKVQVST 155
            .:.|.|:|::.|.::..:.|:|..::
  Fly   780 QNAQAAVKDMRGTILRRKKLQVDFAS 805

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 23/68 (34%)
RRM1_2_CoAA_like 87..152 CDD:409779 15/66 (23%)
hnRNP-R-Q <88..>258 CDD:273732 16/70 (23%)
spenNP_722615.1 RRM2_SHARP 555..628 CDD:240795
RRM3_SHARP 654..726 CDD:240796 24/70 (34%)
RRM4_SHARP 727..803 CDD:240797 20/80 (25%)
RILP-like 1997..>2055 CDD:304877
SPOC 5404..5527 CDD:285043
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.