DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and mod

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001247401.1 Gene:mod / 43764 FlyBaseID:FBgn0002780 Length:542 Species:Drosophila melanogaster


Alignment Length:103 Identity:31/103 - (30%)
Similarity:48/103 - (46%) Gaps:13/103 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EKTQATELRALFEKYGTVVECDVVKN---YGFVHMETEQQGRDAIQNLNGYTLNEFAIKV---EA 74
            |...:..|..:|:|:|.|.|.|||.:   ..||..:.......|:..|:|.|:|:|..|:   |.
  Fly   351 ESYSSDALEKIFKKFGDVEEIDVVCSKAVLAFVTFKQSDAATKALAQLDGKTVNKFEWKLHRFER 415

  Fly    75 AKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQKYGTV 112
            :.|.||       |.|.|||......::|::|...|.:
  Fly   416 STSGRA-------ILVTNLTSDATEADLRKVFNDSGEI 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 19/62 (31%)
RRM1_2_CoAA_like 87..152 CDD:409779 8/26 (31%)
hnRNP-R-Q <88..>258 CDD:273732 8/25 (32%)
modNP_001247401.1 RRM_SF 177..244 CDD:302621
RRM_SF 260..327 CDD:240668
RRM_SF 342..411 CDD:240668 19/59 (32%)
RRM_SF 422..>465 CDD:302621 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439654
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.