DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and rbm34

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001002382.1 Gene:rbm34 / 436655 ZFINID:ZDB-GENE-040718-77 Length:411 Species:Danio rerio


Alignment Length:258 Identity:58/258 - (22%)
Similarity:107/258 - (41%) Gaps:72/258 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFIGNLDEKTQATELRALFEKYGTVVEC----DVVKN----------------------YGFVHM 47
            :|:|||....:..:|.::|:|.| |:|.    .|::.                      ..::..
Zfish   151 VFVGNLPSSCKKKDLLSVFKKSG-VIESVRFRSVIREDPTMSRKVAAIQRKVHPKKQNINAYIVF 214

  Fly    48 ETEQQGRDAIQNLNGYTLNE-FAIKVEAAKSRRAPNTPTTKIFVGNLT-DKTRAPEVRELFQKYG 110
            :.|:...||:: .||:.:.. |.|:|:.. |:.:.:.....||||||. |.:..| ::..||:.|
Zfish   215 KEEESATDALK-WNGHEIQAGFYIRVD
RV-SQHSKHDHKRSIFVGNLPYDISELP-LQNHFQECG 276

  Fly   111 TVVECDIVRN--------YGFVHLDCVGDVQDAIKELNGRVVDGQPLKVQVSTSRVRPKP----- 162
            .:....:||:        :|:|..:....|..|:| |||..:..:.::|:.|..:.:.|.     
Zfish   277 NIEAVRLVRDRDSGMGKGFGYVLFESPDSVMLALK-LNGSTLQQRKIRVKRSVKKEKEKKTPPGR 340

  Fly   163 ---------GMGDPEQCYR--CGRSGHWSKECPRLYGSAGGGREPPSPLSAGGYRDRMYGRDP 214
                     |:..|:|.:|  .||. :::|. ||           ..|..|..::..|  .||
Zfish   341 KAEGQRTGGGLKGPKQEFRNNTGRK-NFTKN-PR-----------NKPTQASSFKGEM--ADP 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 18/90 (20%)
RRM1_2_CoAA_like 87..152 CDD:409779 21/73 (29%)
hnRNP-R-Q <88..>258 CDD:273732 38/152 (25%)
rbm34NP_001002382.1 RRM1_RBM34 149..240 CDD:240840 18/90 (20%)
RRM2_RBM34 253..325 CDD:240841 21/73 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.