DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and CG7903

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster


Alignment Length:311 Identity:84/311 - (27%)
Similarity:120/311 - (38%) Gaps:53/311 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 NTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRNYGFVHLDCVGDVQDAIKELNGRVVDG 146
            || |.|:|||:| .:.:..|:|.||..||:|||||::....||||:.....:.||..|||.:..|
  Fly     2 NT-TAKVFVGSL-PRCKPEELRRLFTNYGSVVECDVMNRCAFVHLENTDMAEAAIAALNGTIFKG 64

  Fly   147 QPLKVQVSTSRVRP------KPGMGD-----PEQC-------------------YRCGRSGHWSK 181
            ||:.|:....:..|      :||.||     |.|.                   :|....|.:|.
  Fly    65 QPIVVEAGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGGGADKRPHESNTNFKRNFREEVGGRFSN 129

  Fly   182 ECPRLYGSAGGGREPPSPLSAGGYRDRMYGRDPYPPPPPPPPFLRDRIMDGFRDYDYYDRRFEDS 246
            |.||...|:.....|..  :...||.:...  ||...||........  .|||:......:|..|
  Fly   130 EGPRSSNSSAAKFGPVR--NESNYRQQRSA--PYSKGPPNNESSNQG--QGFRNKFAGGGKFGGS 188

  Fly   247 RDLYERRYQTSR--MRDFPPPPISRREPMPLPPT------LSGSLRSCSVSRGYDTMFSRRS--- 300
            .. .|.|:.::|  .||...|...||.....|.:      .:...:..|.|.|.....::|:   
  Fly   189 AG-NEGRFGSNRFQQRDNSGPQPGRRNFKNSPTSGYRGGGNNSDFQGGSSSSGGGGSVNQRAGGG 252

  Fly   301 -PPPPRSSNGMSRYGSPTPHGYEDFSRDAFDERMISS--RGMRGPSPPGRR 348
             |.|.........:..|..|..:......|....::|  ||..|.:|||.|
  Fly   253 GPGPSHVRQDRRGFALPVEHQQQQMGFGRFGNGPMNSGNRGTNGGNPPGGR 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 28/64 (44%)
hnRNP-R-Q <88..>258 CDD:273732 56/199 (28%)
CG7903NP_651755.2 RRM <4..168 CDD:223796 51/168 (30%)
RRM_SF 6..70 CDD:302621 28/64 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447422
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1563362at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.