DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and B52

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster


Alignment Length:354 Identity:79/354 - (22%)
Similarity:115/354 - (32%) Gaps:112/354 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLFIGNLDEKTQATELRALFEKYGTVVECDVVKNYGFVHMETEQQGRDAIQNLNGYTLNEFAIKV 72
            ::::|.|....:..:|...|:.||...:..:...||||..|..:...||:..|||..|....:.|
  Fly     5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKNGYGFVEFEDYRDADDAVYELNGKELLGERVVV 69

  Fly    73 EAAK------------------------------------SRRAPNTPTT-KIFVGNLTDKTRAP 100
            |.|:                                    ||..|...|. ::.|.||:.:....
  Fly    70 EPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSRVSWQ 134

  Fly   101 EVRELFQKYGTVVECDI---VRNYGFVHLDCVGDVQDAIK-----ELNGRVVDGQPLKVQVSTSR 157
            ::::..::.|.|...|.   .||.|.|....:.|::.||:     |||||       ::.:...|
  Fly   135 DLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGR-------RIHLVEDR 192

  Fly   158 VRPKPGMGDPEQCYRCGRSGHWSKECPRLYGSAGGGR-EPPSPLSAGGYRDRMYGRDPYPPPPPP 221
                          |.||||          |..|.|| ...|..|....|.|...|         
  Fly   193 --------------RGGRSG----------GGGGSGRGRSRSSSSRSRSRSRRRSR--------- 224

  Fly   222 PPFLRDRIMDGFRDYDYYDRRFEDSRDLYERRYQTSRMRDFPPPPISRREPMPLPPTLSGSLRSC 286
                              .||...||.....|.::...|.....|:..|.     .:.|.|.:|.
  Fly   225 ------------------SRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRS-----RSRSRSNKSR 266

  Fly   287 SVSRGYDTMFSR---RSPPPPRSSNGMSR 312
            .||:......||   |||...|.|...||
  Fly   267 DVSKSKSKSHSRTRSRSPKRERDSRSRSR 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 17/64 (27%)
RRM1_2_CoAA_like 87..152 CDD:409779 18/72 (25%)
hnRNP-R-Q <88..>258 CDD:273732 38/178 (21%)
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 20/68 (29%)
RRM2_SRSF4_like 120..191 CDD:241044 18/77 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.