DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and Rbp1

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster


Alignment Length:144 Identity:36/144 - (25%)
Similarity:56/144 - (38%) Gaps:28/144 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRN---YGFVHLDCVGDVQDAIKELNGRVVDGQP 148
            |::||||.......|:...|.|||.:....:.||   :.||..:...|.:||.:.|:|....|..
  Fly    12 KVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATRALDGTRCCGTR 76

  Fly   149 LKVQVSTSRVRPKPGMGDPEQCYRCGRSGHWSKECPRLYGSAGGGR-------EPPSPLSAGGYR 206
            ::|::|:.|.|.:          |.|..|.        .|.:|.||       ...|..::..|.
  Fly    77 IRVEMSSGRSRDR----------RRGEGGS--------SGRSGSGRYRITPSARTTSTATSSFYN 123

  Fly   207 DRMYGRDPYPPPPP 220
            .....:.|...|.|
  Fly   124 INNLQQQPSSQPQP 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 20/67 (30%)
hnRNP-R-Q <88..>258 CDD:273732 35/143 (24%)
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 21/68 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.