DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lark and srsf7a

DIOPT Version :9

Sequence 1:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_991236.1 Gene:srsf7a / 402972 ZFINID:ZDB-GENE-040426-1798 Length:258 Species:Danio rerio


Alignment Length:290 Identity:78/290 - (26%)
Similarity:113/290 - (38%) Gaps:61/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 SRRAPNTPTTKIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRN---YGFVHLDCVGDVQDAIKE 138
            ||.:..|...|::||:|.:.....|:...|..||.:....:.||   :.||..:...|.:||:|.
Zfish     5 SRSSSRTSDCKVYVGDLGNGAAKGELERAFSYYGPLRSVWVARNPPGFAFVEYEDARDAEDAVKG 69

  Fly   139 LNGRVVDGQPLKVQVST-----SRV-RPKPGMGDP-EQCYRCGRSGHWSKECPRLYGSAGGGREP 196
            ::|:|:.|..::|::|.     ||. ||.....|| ::||:||.:||::.:|.|.       .:.
Zfish    70 MDGKVLCGARVRVELSNGMSRKSRYGRPSRRQFDPNDRCYQCGETGHYAYDCYRF-------SKR 127

  Fly   197 PSPLSAGGYRDRMYGRDPYPPPPPPPPFLRDRIMDGFRDYDYYDRRFEDSRDLYERRYQT---SR 258
            .|..|..|.|.|...|                           .||:.......||||::   |:
Zfish   128 RSRRSRSGSRSRSRSR---------------------------GRRYRSRSRSNERRYRSPSYSK 165

  Fly   259 MRDFPPPPISRREPMPLPPTLSGSLRSCSVSRGYDTMFSRRSPPPPRSSNGMSRYGSPTPHGYED 323
            .|.....|...|...|...:.|...||.|..|.     ||...|..|.|...||..|.:......
Zfish   166 RRSRSGSPGRSRSRSPGGRSRSPVRRSKSPVRR-----SRSRTPLHRDSRSRSRSRSGSRQRDRS 225

  Fly   324 FSRDAFDERMIS------SRG---MRGPSP 344
            .||.....|.||      ||.   .|.|:|
Zfish   226 VSRSRSRSRSISHKKDSHSRSASPRRSPTP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779
RRM1_2_CoAA_like 87..152 CDD:409779 19/67 (28%)
hnRNP-R-Q <88..>258 CDD:273732 46/182 (25%)
srsf7aNP_991236.1 RRM_SRSF3_like 15..87 CDD:240819 21/71 (30%)
zf-CCHC 108..121 CDD:278525 6/12 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.